KEGG   Rattus norvegicus (rat): 80338Help
Entry
80338             CDS       T01003                                 

Gene name
Zbtb10, Rinzf
Definition
(RefSeq) zinc finger and BTB domain containing 10
  KO
K10497  zinc finger and BTB domain-containing protein 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    80338 (Zbtb10)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     80338 (Zbtb10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB zf-H2C2_5 zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3342 BTB_2 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 80338
NCBI-ProteinID: NP_077815
RGD: 708377
Ensembl: ENSRNOG00000061862
UniProt: Q9WTY8
Position
2q23
AA seq 836 aa AA seqDB search
MGPGRRGNGIGGPGAPRLGGLRRGGRRGGRQGVAAPLGHGRPRLAGRRRGGPPASGKEPS
DSGLPRGRRRGSRQQWQQSRPPGDLGVAPQAFQWARAGGRGSGAGRAGGEGVDAGRGVPE
LQHRGGGGEPGRWQWGGRRQRSSSRRSGGEGGEEAEGSGVGAGEGETVQHFPLARPKSLM
QKLQCSFQTSWLKDFPWLRYSNDTGLMFCGWCQTTPEDVGSVDLPQVGHDELSRGTRNYK
KTLLLRHHVSTEHKLHEANAQVLGSQACVTVDGSAVDKPDASEGCLLVGNESEIPSEEGY
CDFNSRPNENSYCYQLLRQLDEQRKKDILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYC
VSNKESPNQNNTTHLDIAAVQGFSVILDFLYSGNLVLTSQNAIEVMTVASYLQMSEVVQT
CRNFIKDALNISIKSEAPESVVVDYNNRKPVSRDGLTSSRDQKIASFWATRNLTNLASNI
KIENDGCNVDEGQIENYQMNDSNWVQDGSPELAENESQGKTKVFIWNNMASQETGKARRK
NQTTKRFVYNIPPNSETIVEDCSVLQPPVAYPEENKALLIKEEPVSDLDGALLSGPDGDR
TMNTNLLAEACSSQDAGDAAGASHDFKYGLMPGTSSDFKYGLLPSTSNDFKYGLLPGAPN
DFKYGLLPESWPTQEPWENGDSSLIMNKLKCPHCSYVAKYRRTLKRHLLIHSGVRSFKCE
ICGKMFTRREHVKRHSLVHKKDKKYKCMVCKKIFMLAASVGIKHGSRRYGVCMDCVDKSQ
PGGQESIDQGQDTEFPRDEEYEENEGVEPDEELAEDGQDQSDAPRWDEPGGAYVSG
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggccgacgaggaaatggaatcggagggcctggagccccaagactcggaggc
ctccgccggggcggccgccgcggaggacgccaaggagttgctgctcccctaggacacggg
cggccccgccttgctgggcggcggcgcggggggccccctgctagcggaaaggaaccgtcg
gactctggccttccgcgggggaggcggcgggggtctcggcaacaatggcagcagtcgcgg
ccgcccggagacctcggcgtggcccctcaggcatttcaatgggcgagggctggcggccgt
ggatccggagctggacgcgctggaggggaaggagttgatgcaggacggggcgtccctgag
ctacagcaccgaggaggagggggcgagcccgggcgatggcagtggggcggaaggcggcag
cgcagcagcagcaggcggtcgggaggcgaaggcggggaagaagcagagggcagcggtgtg
ggagctggagaaggagagactgtccagcacttcccgctcgcgaggcccaagtccctcatg
cagaagctccagtgctccttccagacctcttggctcaaggacttcccttggctgcggtac
tccaatgatactggccttatgttttgcggctggtgccaaacgacccccgaggatgtgggc
agcgtggaccttccccaggtggggcatgatgagctttcgcgagggacccgcaactacaag
aaaaccctgctcctgaggcaccacgtctccaccgaacacaaactccacgaagccaacgcc
caggtgttaggatcacaggcatgtgtcactgtcgatggaagtgctgttgataaacccgat
gcaagtgaggggtgtttactggtgggaaatgagtcagaaataccatcagaggagggatac
tgtgactttaatagtaggccaaatgagaactcctattgctatcaacttcttcgacaacta
gatgaacagagaaagaaagatattctttgtgatgtcagcattgtggtgagcgggaaaatc
tttaaagctcataagaacatcctggttgcaggcagccgtttctttaagactttatattgt
gtttcaaacaaagaaagccctaaccaaaacaatactacccacttagatattgctgcagtt
caaggtttttcagtcatcttggacttcctgtattctgggaacctggtgctcacaagccaa
aatgccattgaagtgatgacagtggccagctaccttcaaatgagtgaagttgttcaaact
tgcagaaattttattaaagatgccttaaatattagcattaaatcagaagctccagagtct
gtagttgtggactataataataggaaaccagttagtagagatggcctgacttcatcacgg
gatcaaaaaattgccagcttctgggcgacacggaatcttaccaatttggcaagtaatata
aaaattgaaaatgatggttgtaatgtcgacgagggccaaatagaaaactaccagatgaat
gacagtaactgggtccaggatggttctcctgaattggctgaaaatgaatctcaaggtaaa
acaaaagtgtttatttggaataatatggcctctcaagagactggcaaagcaaggaggaaa
aaccaaactacaaagagatttgtctataatataccaccgaatagtgagacaatagtcgaa
gactgctccgtgttgcagccacctgttgcctatccggaagaaaataaggccctactcatc
aaggaagagccagtttcagatttggatggcgcactactctcagggcctgatggtgatagg
accatgaatacaaatttattggctgaagcctgcagtagtcaagatgcaggagatgctgct
ggagcatcacatgatttcaagtatggtttgatgcctggcacttcaagtgatttcaagtat
gggttactaccaagtacttcaaatgacttcaaatacggattgctaccgggtgctccaaat
gatttcaagtatggattattgccagaatcttggcccacacaagagccgtgggaaaatggt
gactcatctctaatcatgaacaagttgaaatgccctcattgtagctatgtagccaagtac
aggcggacactaaagaggcacttgctcatccattctggagtaagatcctttaagtgtgaa
atttgtggaaagatgtttactagaagagaacacgtgaaaagacattccctggtgcataaa
aaggataaaaaatacaaatgcatggtgtgtaagaagatcttcatgttagcagccagtgtt
ggaataaaacatggatctcgacgctacggagtatgcatggactgtgtagataaatcacaa
ccaggagggcaggaaagcatagatcagggacaagatacagagttccctcgggatgaagag
tatgaggaaaacgaaggagtcgagcctgatgaagagctagctgaggacggacaggatcag
agcgatgcaccgcggtgggatgaaccgggaggcgcttacgtctctggatga

DBGET integrated database retrieval system