KEGG   Rattus norvegicus (rat): 80722Help
Entry
80722             CDS       T01003                                 

Gene name
Sost
Definition
(RefSeq) sclerostin
  KO
K16834  sclerostin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    80722 (Sost)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    80722 (Sost)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sclerostin DAN Cys_knot
Motif
Other DBs
NCBI-GeneID: 80722
NCBI-ProteinID: NP_085073
RGD: 69358
Ensembl: ENSRNOG00000020805
UniProt: Q99P67
Position
10q32.1
AA seq 213 aa AA seqDB search
MQLSLAPCLACLLVHAAFVAVESQGWQAFKNDATEIIPGLREYPEPPQELENNQTMNRAE
NGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG
RVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELK
DFGPETARPQKGRKPRPRARGAKANQAELENAY
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctcactagccccttgccttgcctgcctgcttgtacatgcagccttcgttgct
gtggagagccaggggtggcaagccttcaagaatgatgccacagaaatcatcccgggactc
agagagtacccagagcctcctcaggaactagagaacaaccagaccatgaaccgggccgag
aacggaggcagacccccccaccatccttatgacaccaaagacgtgtccgagtacagctgc
cgcgagctgcactacacccgcttcgtgaccgacggcccgtgccgcagtgccaagccggtc
accgagttggtgtgctcgggccagtgcggccccgcgcggctgctgcccaacgccatcggg
cgcgtgaagtggtggcgcccgaacggacccgacttccgctgcatcccggatcgctaccgc
gcgcagcgggtgcagctgctgtgccccggcggcgcggcgccgcgctcgcgcaaggtgcgt
ctggtggcctcgtgcaagtgcaagcgcctcacccgcttccacaaccagtcggagctcaag
gacttcggacctgagaccgcgcggccgcagaagggtcgcaagccgcggccccgcgcccgg
ggagccaaagccaaccaggcggagctggagaacgcctactag

DBGET integrated database retrieval system