KEGG   Rattus norvegicus (rat): 80840Help
Entry
80840             CDS       T01003                                 

Gene name
Gpr12, Gpcr12
Definition
(RefSeq) G protein-coupled receptor 12
  KO
K04315  G protein-coupled receptor 12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    80840 (Gpr12)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    80840 (Gpr12)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     80840 (Gpr12)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    80840 (Gpr12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 80840
NCBI-ProteinID: NP_001032372
RGD: 68333
Ensembl: ENSRNOG00000039832
Vega: OTTRNOG00000001861
UniProt: P30951
Position
12p11
AA seq 334 aa AA seqDB search
MNEDPKVNLSGLPRDCIEAGTPENISAAVPSQGSVVESEPELVVNPWDIVLCSSGTLICC
ENAVVVLIIFHSPSLRAPMFLLIGSLALADLLAGLGLIINFVFAYLLQSEATKLVTIGLI
VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSTCLGLLPVMGWN
CLRDESTCSVVRPLTKNNAAILSISFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT
SHYVTTRKGISTLALILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI
YAFRNQEIQKALCLICCGCIPNTLSQRARSPSDV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagacccgaaggtcaatttaagcgggctgcctcgggactgtatagaagctggt
actccggagaacatctcagccgctgtcccctcccagggctctgttgtggagtcagaaccc
gagctcgttgtcaacccctgggacattgtcttgtgcagctcaggaaccctcatctgctgt
gaaaatgccgtcgtggtccttatcatcttccacagccccagcctgcgagcacccatgttc
ctgctgataggcagcctggctcttgcagacctgctggctggtctgggactcatcatcaat
tttgtttttgcctacctgcttcagtcagaagccaccaagctggtcacaattggactcatt
gtcgcctctttctctgcctctgtctgcagtttgctggctatcactgtggaccgctacctc
tcgctgtattacgccctgacgtaccactccgagaggaccgtcacctttacctatgtcatg
ctagtgatgctctggggaacttccacctgcctggggctgctgcctgtcatgggctggaac
tgcctgagggacgagtccacctgcagcgtggtcagacccctcactaagaacaacgccgcc
attctctccatctccttcctcttcatgttcgcactgatgctccaactctacatccagatt
tgtaagattgtgatgaggcacgcccatcagatagccctgcagcaccacttcctggctacg
tcgcactacgtgactacccggaaagggatctccaccctggctctcatcctggggaccttt
gccgcctgctggatgccttttaccctctattccttgatcgccgattacacctacccctcc
atctacacctacgccaccctcctgcccgccacgtacaattccatcatcaaccctgtcata
tatgctttcagaaaccaagagatccagaaagccctctgcctcatctgctgtgggtgcatc
cctaacacgctgtcccagagagcacgctctcccagcgatgtgtag

DBGET integrated database retrieval system