KEGG   Rattus norvegicus (rat): 80843Help
Entry
80843             CDS       T01003                                 

Gene name
Sec61a1, Sec61a
Definition
(RefSeq) Sec61 translocon alpha 1 subunit
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    80843 (Sec61a1)
   04141 Protein processing in endoplasmic reticulum
    80843 (Sec61a1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    80843 (Sec61a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    80843 (Sec61a1)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   80843 (Sec61a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SecY Plug_translocon DUF2975
Motif
Other DBs
NCBI-GeneID: 80843
NCBI-ProteinID: NP_954865
RGD: 68321
Ensembl: ENSRNOG00000013743
UniProt: P61621
Position
4q34
AA seq 476 aa AA seqDB search
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSN
LYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaaatttctggaagtcatcaagccattctgtgtcatcttgccggaaattcag
aagccagagagaaagattcagtttaaggagaaggtgttgtggacggccatcaccctcttc
atcttcttagtatgctgccagattcccctgtttggcatcatgtcttcagactcagctgac
cccttctactggatgcgagtgattctggcctctaacagaggtaccttgatggagctgggt
atctctcctattgtcacgtccggccttatcatgcagctcttagctggtgccaagataatt
gaagttggggacaccccgaaagaccgagctctcttcaatggagcccaaaagttgtttgga
atgatcatcactatcggtcagtccattgtgtacgtgatgacgggcatgtacggggaccct
tcagagatgggtgctggaatctgcctgctgatcaccattcagctctttgttgctggctta
attgtcctacttttggatgaactcctgcagaaaggatatggcttgggctctggcatctct
ctcttcattgcgactaatatctgtgagaccattgtatggaaggcattcagccccaccact
gtcaacactggccgagggatggaatttgaaggcgccatcattgcgctgttccacctgctg
gccacccgcacagacaaggtccgagcccttcgagaggcattctaccgccagaacctccct
aacctcatgaacctgattgccaccatcttcgtctttgctgttgtcatctatttccagggc
ttccgagtggaccttccaatcaagtcggcgcgttaccgaggccagtacaatacctacccc
atcaagctcttctacacctccaacattcccatcatcttgcagtctgctctggtgtccaac
ctgtatgtcatctcccagatgctgtcagcacgtttcagtggcaacctgctggttagcctg
ctgggcacctggtcggatacgtcatctgggggcccagcccgtgcttacccagttggtggc
ctgtgttactacctgtctcctccggaatcattcggctcagtgctggaggaccctgtccat
gcggtcgtgtacattgtattcatgctgggttcctgtgcattcttttccaaaacatggatc
gaagtttcgggttcttctgccaaagatgttgccaagcagctgaaggagcagcagatggtg
atgagaggccacagggagacctccatggtgcatgagctcaaccggtacatccccacagct
gcagccttcggtgggctgtgcattggggccctctctgtcctggctgatttcctgggtgct
atcgggtctggcaccgggatcctgctggcggtcaccatcatctaccagtactttgagatc
ttcgtcaaagagcagagcgaggtgggcagcatgggagcccttctcttctga

DBGET integrated database retrieval system