KEGG   Rattus norvegicus (rat): 80878
Entry
80878             CDS       T01003                                 

Gene name
Slc16a3, MCT4, Mct3
Definition
(RefSeq) solute carrier family 16 member 3
  KO
K08180  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    80878 (Slc16a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    80878 (Slc16a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   80878 (Slc16a3)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    80878 (Slc16a3)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 80878
NCBI-ProteinID: NP_110461
RGD: 620603
Ensembl: ENSRNOG00000036677
UniProt: O35910 B4F761
Position
10q32.3
AA seq 471 aa
MGGAVVDEGPTGIKAPDGGWGWAVLFGCFIITGFSYAFPKAVSVFFKELMHEFGIGYSDT
AWISSILLAMLYGTGPLCSMCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQIYLTTGV
ITGLGLALNFQPSLIMLNRYFNKRRPMANGLAAAGSPVFLCALSPLGQLLQDHYGWRGGF
LILGGLLLNCCVCAALMRPLVAPQASGGAEPHGPQRPSPRLLDLSVFRDRGFLIYAVAAS
IMVLGLFVPPVFVVSYAKDMGVPDTKAAFLLTILGFIDIFARPTAGFITGLKKVRPYSVY
LFSFAMFFNGFTDLTGSTASDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTQKFSSAI
GLVLLLEAVAVLIGPPSGGKLLDATKVYKYVFILAGAEVLTSSLVLLLGNFFCIGKRKRP
EVTKPEEVASEEEKLHKPPVDVRVDSREVEHFLKAEPEKNGEVVHTPETSV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgggaggagctgtggtggacgagggtcccaccggcatcaaggcccccgatgggggctgg
ggctgggccgtcctctttggctgtttcatcatcacgggcttctcctatgccttccccaaa
gcggtcagtgtttttttcaaggagctcatgcatgagtttgggattggctacagcgacaca
gcttggatctcctccatcctgctggctatgctgtatggcacaggcccactctgcagtatg
tgtgtgaaccgctttggctgccggcccgtcatgcttgtgggtggcctctttgcgtccctg
gggatggtggctgcatccttctgcagaagcattatccagatctacctcaccacaggggtc
atcactggcttgggtctggctctcaacttccagccctccctcatcatgctcaatcgatac
ttcaacaagcgccgccctatggccaatgggctggcagcagcaggcagtcccgtgttcctt
tgtgcactgtctccactggggcagctgctgcaggaccactatggctggcggggtggcttc
ctcatcctgggaggcctgctgctcaactgctgcgtgtgtgctgcactcatgagaccactg
gtagcaccccaggcgagtggaggggctgagccccatggaccccagcggccgtctccgcgc
ctgctagacctgagtgtcttccgagaccgtggcttcctcatctatgctgtggctgcctca
atcatggtgctggggctctttgtgcctccggtctttgtggtgagctatgctaaggatatg
ggtgtgcctgacacaaaggctgccttccttctcaccatcctgggcttcatcgacatcttt
gccaggcccacggcaggtttcataacagggctcaagaaggtgcggccctactctgtctac
ctcttcagctttgccatgttcttcaatggcttcactgacctgacaggctccacggccagt
gactacggtggcctggtggtcttttgcatcttctttgggatctcgtatggcatggtggga
gcgctacagtttgaggtgctcatggctatcgtgggcactcaaaagttctccagtgccatt
ggtctcgtgctgctgttagaggctgtggctgtgctcatcggacccccatcaggaggcaag
ctgctggacgcaacgaaagtttacaagtatgtgttcatcctggcgggggctgaggtgctc
acctcctcccttgtgctgctgctgggcaacttcttctgcatcgggaagaggaagaggccc
gaggtgacaaagcctgaggaggtggcctcagaggaggagaagctccacaagccccctgtg
gacgtgagggtggactcgagggaggtggagcacttcctgaaggcagagcctgagaaaaac
ggggaggtggttcataccccggaaaccagcgtgtga

DBGET integrated database retrieval system