KEGG   Rattus norvegicus (rat): 80897Help
Entry
80897             CDS       T01003                                 

Gene name
Erap1, Appils, Arts1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    80897 (Erap1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     80897 (Erap1)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M1
   80897 (Erap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Motif
Other DBs
NCBI-GeneID: 80897
NCBI-ProteinID: NP_110463
RGD: 708542
Ensembl: ENSRNOG00000009997
UniProt: Q9JJ22
Position
2q11
AA seq 884 aa AA seqDB search
MPSLLSLVLTFLAVSSPSCCQNSDTASPKASNGASFPWNNMRLPEYITPIHYDLMIHANL
STLTFWGKTEVEITVSQPTSTIIMHSHQLQISKATLRRGAEEMLPEEPLKLMEYSAHEQV
ALLTAQPLLAGSVYTVIITYAANLSENFHGFYKSTYRTQEGERRILAATQFEPTAARMAF
PCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVTVAEGLIEDHFDITVKMSTYLVAFII
SDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRESALLYDKEKSSASSKLGITMTVSHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEFVSVTVTHPELKVEEYFFGKCFNAMEVDALNSSHPVSTPVENPAQIRE
MFDEVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYSYKNTKNEDLWNSMMHICPTDGT
QTMDGFCSRNQHSSSTSHWRQEVIDIKSMMNTWTLQKGFPLITITVRGRNVHLKQEHYMK
GSECFPETGSLWHVPLTFITSKSDSVQRFLLKTKTDVIILPEAVEWIKFNVGMNGYYIVH
YGDDGWASLNGLLKEAHTTISSNDRASLINNAFQLVSIGKLSIEKALDLILYLKNETEIM
PIFQGLNELIPMYKLMEKRDMVEVETQFKDFLLRLLKDLINKQTWTDEGSVSERMLRSQL
LLLACVHRYQLCVQRAERYFREWKASNGNMSLPIDVTLAVFAVGAQNTEGWDFLYSKYQS
SLSSTEKSQIEFSLCISQDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWK
FLKENWNKIVQKFELGSSSIAHMVMGTTNQFSTRARLEEVKGCM
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgccctctcttctttccctagtattgacctttttagctgtgtcttctccttcttgttgt
cagaacagtgacacagcatctccaaaagctagtaatggggcctcattcccttggaataat
atgcgacttcctgagtatatcaccccaattcattatgatctcatgatccatgcaaacctt
agcactctgactttctgggggaaaacagaagtagaaatcacagttagccagcccaccagc
accattatcatgcatagtcaccagctgcaaatatctaaggccaccctcaggagaggagct
gaagagatgctgcctgaagaaccactgaagctcatggaatattctgctcatgagcaagtt
gcactgctgactgcccagccgctccttgctgggtccgtgtacacagttatcatcacctat
gctgccaacctgtctgagaatttccatggattctataaaagcacctacagaacacaggag
ggggaaaggagaatacttgcagcaacacagtttgaacccacagctgctagaatggctttt
ccctgctttgatgagcctgccctcaaggcaagtttttccatcaagataaagagggatcca
aggcacctggccatctccaacatgcccttggtgaaatctgtgactgttgctgaaggactc
atagaagaccattttgacatcactgtgaaaatgagcacctaccttgtggccttcattatt
tctgattttaagtctgtgagcaagatgactaagagtggagtcaaggtctctgtgtatgct
gtgccagacaagataaatcaagcagattatgctctggatgctgcagtgactcttctagag
ttttatgaggattatttcagcattccatatcctttacccaagcaagatcttgctgcaatt
ccagactttcagtctggtgctatggaaaactggggcctgaccacatacagagaatctgct
ttgttatatgataaagaaaagtcttctgcatccagtaagcttggcatcacaatgactgta
tcccatgaactggctcaccagtggttcgggaacttggtcacaatggaatggtggaatgac
ctttggctcaatgaaggatttgccaaatttatggagtttgtgtctgtcactgtgacccat
cctgaattaaaagttgaagaatatttttttggcaagtgttttaatgcaatggaagttgat
gcattaaactcctctcaccctgtatccacacctgtggagaatcctgcacagattcgggag
atgtttgatgaggtttcttatgaaaagggtgcttgtattctgaatatgctaagagattat
ctgagtgcagatacatttaaaagaggaattgtacagtatcttcaaaagtatagttataaa
aacacgaaaaatgaggacctgtggaatagcatgatgcatatttgtcccacagatggcaca
caaacaatggatggcttttgctctaggaaccaacactcatcatcaacctcacactggcgt
caggaggttatagatataaagagcatgatgaacacatggacactgcagaagggctttcct
ctgataaccatcactgtaagagggcggaatgtgcacttgaagcaagaacactacatgaaa
ggttctgaatgcttcccagagactgggtctctgtggcatgttccgctgacattcattacc
agcaaatcagattcagtccagagatttttgctgaagacaaagacagatgtgatcatcctc
ccagaagcagtggaatggatcaaatttaatgtaggaatgaatggctattacattgtgcat
tacggggatgatggatgggcttctctgaatggcctcttaaaagaagcacatacaacaatc
agcagtaatgatcgggcaagtctcatcaacaatgcatttcagctggtcagcatcggaaag
ttatcaattgaaaaagccctggatttaatcctgtacttgaaaaatgaaactgaaattatg
cccatattccaaggtttgaatgaactgatacctatgtataagttaatggagaaaagagat
atggttgaggtggaaactcaattcaaggactttctcctcaggctgctaaaggaccttatt
aataagcagacctggacagatgaaggctctgtctcagagaggatgctcaggagccagctc
ttactcctagcatgtgtgcacaggtatcagctctgcgtgcagagggcagagcgctatttc
agagagtggaaggcatccaatggaaacatgagcctccctattgatgtgaccttggcggtg
tttgctgttggggcccagaacacagaaggctgggattttctttatagtaaatatcagtct
tctttgtctagtaccgagaaaagccaaattgaattttccctctgcataagccaagaccca
gaaaaacttcagtggcttctagaccaaagttttaagggagagataataaaaactcaggaa
ttcccacatattctcacgctcattggcagaaacccagtgggttatccattggcctggaag
tttctgaaggaaaattggaacaagattgtacagaaatttgaacttggctcatcatccata
gctcacatggtaatgggaacaacaaaccagttttccaccagagcacgtcttgaagaggta
aaggggtgtatgtga

DBGET integrated database retrieval system