KEGG   Rattus norvegicus (rat): 80977Help
Entry
80977             CDS       T01003                                 

Gene name
Syt13
Definition
(RefSeq) synaptotagmin 13
  KO
K19913  synaptotagmin-13
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    80977 (Syt13)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    80977 (Syt13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 PI3K_C2
Motif
Other DBs
NCBI-GeneID: 80977
NCBI-ProteinID: NP_110466
RGD: 621877
Ensembl: ENSRNOG00000008000
UniProt: Q925B5
Position
3q31
AA seq 426 aa AA seqDB search
MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDREPDPEKARPGVLQAAQ
QFNVKKSTEPVQPRPLLKFPDIYGPRPAVTAPEVINYADYTLGTTEESAAPASPQAQSDS
RLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHFRLDYDQKKAELFVTSL
EAVTSDHEGGCDCYIQGSVAVKTGSVEAQTALKKRQLHTTWEEGLTLPLGEEELPTATLT
LTLRTCDRFSRHSVIGELRLGLNGASVPLGTAQWGELKTTAKEPSAGTGEVLLSISYLPA
ANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQAQKLKKKQTKRAKHKINPVWNEMI
MFELPDDLLQASSVELEVLGQGEEGPSCELGRCSLGLHASGSERSHWEEMLKNPRRQIAM
WHQLHL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggttctttcggtgcctgtgatcgcgctgggcgccacgctgggcactgccaccagcatc
cttgcactgtgtggggtcacttgcctgtgccgacacatgcaccccaagaaagggttgctg
ccgcgggaccgtgagcccgacccggagaaagcgaggcccggtgtgctccaggcagcccaa
cagttcaacgttaaaaagtccacagagcctgtccagccccgacctctccttaagttcccg
gacatctacggtccccggccagctgtgacggccccagaagtcatcaactacgcagactac
accctggggaccacagaggagtctgctgcacctgccagcccccaggcccagagtgacagt
cgcctcaagaggcaggtcacagaggagctgttcatcctccctcagaacggtgtagtagag
gatgtctgtgtcatggagacctggaacccagagaaggctgccagctggaaccaggcccca
aaactccactttcgcctggactatgaccagaagaaggccgagttatttgtgactagcctg
gaagctgtcaccagtgaccacgaaggaggctgtgactgttacatccagggcagcgtggct
gtcaagacaggctctgtggaggcacagacggctctgaagaaacggcagctgcacacaacc
tgggaggagggcctgaccctgcccctgggtgaggaagagctccccacagctaccctgaca
ctcaccctgaggacctgtgaccgcttctccagacatagtgtgattggggaactccgcctg
ggcctgaatggagcatctgtacccctggggacagcacagtggggtgaactgaagaccaca
gcaaaggagccatctgcaggaactggggaggtccttctgtcaatcagctaccttccagct
gccaatcgcctcctggtggtgctgattaaagctaagaacctccactccaaccaatccaag
gagcttctaggcaaagatgtctctgtcaaggtgaccttgaaacaccaggctcagaagctg
aagaagaaacagacaaaacgggccaagcacaagatcaaccccgtgtggaatgagatgatc
atgtttgagctaccagatgacctgctgcaggcatccagtgtggagctggaggtgctgggc
cagggtgaggaggggccgagctgcgagcttgggcgctgcagcctgggcctgcacgcctct
ggctctgagcgaagccactgggaggagatgctaaaaaacccacgccggcagatcgccatg
tggcaccaattgcacctgtag

DBGET integrated database retrieval system