KEGG   Rattus norvegicus (rat): 81507
Entry
81507             CDS       T01003                                 

Gene name
Bmpr1a
Definition
(RefSeq) bone morphogenetic protein receptor type 1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04350  TGF-beta signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    81507 (Bmpr1a)
   04390 Hippo signaling pathway
    81507 (Bmpr1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    81507 (Bmpr1a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    81507 (Bmpr1a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    81507 (Bmpr1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81507 (Bmpr1a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    81507 (Bmpr1a)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     81507 (Bmpr1a)
Protein kinases [BR:rno01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   81507 (Bmpr1a)
CD molecules [BR:rno04090]
 Proteins
  81507 (Bmpr1a)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 81507
NCBI-ProteinID: NP_110476
RGD: 70989
Ensembl: ENSRNOG00000052469
UniProt: Q78EA7
Position
16p15
AA seq 532 aa
MTQLYTYIRLLGACLFIISHVQGQNLDSMLHGTGMKSDVDQKKPENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSVRWLAVLISMAVCIVAMIVFSSCFCYKHYC
KSISSRGRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDIPLNTRVGTRRYMAPEVLDESLSKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgactcagctatacacttacatcagattactgggagcctgtctgttcatcatttctcat
gttcaagggcagaatctagatagtatgctccatggtactggtatgaaatcagacgtggac
cagaagaagccggaaaatggagtgacgttagcaccagaggacaccttacctttcttaaaa
tgctattgctcaggacactgcccagatgacgctattaataacacatgcataactaatggc
cattgctttgccattatagaagaagatgatcagggagaaaccacgttaacttctgggtgt
atgaagtatgaaggctctgattttcaatgcaaggattcaccaaaagcccagctacgcagg
acaatagaatgttgtcggaccaatttgtgcaaccaatatttgcagcctacactgccccct
gtcgttataggcccattctttgatggcagcgtccgatggctggctgtgctcatctctatg
gctgtctgtattgtcgccatgatcgtcttctccagctgcttctgttacaaacattactgt
aagagtatctcaagcagaggtcgttacaaccgtgacttggaacaggatgaagcatttatt
ccagtaggagaatcactgaaagacctgattgaccagtcacaaagctctggtagtggatct
ggattacctttattggttcagcgaactattgccaaacagattcagatggttcggcaggtt
ggtaaaggccggtatggagaagtatggatgggtaaatggcgtggtgaaaaagtggctgtc
aaagtattttttaccactgaagaagctagctggtttagagaaacagaaatctaccagacg
gtgttaatgcgtcatgaaaatatacttggttttatagctgcagacattaaaggcaccggt
tcctggactcagctgtatttgattactgattaccatgagaatgggtctctctatgacttc
ctgaaatgtgccaccctggacaccagagccctactcaagttagcttattctgctgcctgt
ggtctgtgccacctccacacagaaatttatggcacgcaaggcaagcctgcaattgctcat
cgagacctgaagagcaaaaacatccttattaagaaaaatggtagttgctgtattgctgac
ctgggcctagctgttaaattcaacagtgacacaaatgaagttgacatacccttgaacacc
agggtgggcaccaggcggtacatggctccagaagtgctggacgagagcctgagtaaaaac
catttccagccctacatcatggctgacatctacagctttggtttgatcatttgggagatg
gcccgtcgctgtattacaggaggaatcgtggaggaatatcaattaccatattacaacatg
gtgcctagtgacccatcttatgaagacatgcgtgaggtcgtgtgtgtgaaacgcttgcgg
ccaatcgtctctaaccgctggaacagtgatgaatgtcttcgagccgttttgaagctgatg
tcagaatgctgggcccataatccagcatccagactcacagctttgagaatcaagaagacg
ctcgcaaagatggttgaatcccaggatgtaaagatttga

DBGET integrated database retrieval system