KEGG   Rattus norvegicus (rat): 81509Help
Entry
81509             CDS       T01003                                 

Gene name
Bdkrb1, BKR, Bdkrb, b1bkr
Definition
(RefSeq) bradykinin receptor B1
  KO
K03915  bradykinin receptor B1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    81509 (Bdkrb1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81509 (Bdkrb1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81509 (Bdkrb1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    81509 (Bdkrb1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81509 (Bdkrb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81509 (Bdkrb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    81509 (Bdkrb1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Bradykinin
    81509 (Bdkrb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 81509
NCBI-ProteinID: NP_110478
RGD: 620401
Ensembl: ENSRNOG00000004488
UniProt: P97583
Position
6q32
AA seq 337 aa AA seqDB search
MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSF
FLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLC
RVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSI
PTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLR
GQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEIT
DLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgaggtcttgttggagctccagccctctaaccgaagcctgcaggcccctgcc
aacattacctcctgcgagagtgccctagaagactgggacctgctgtatcgggtgctgcca
gggttcgtcatcactatctgcttctttggcctcttggggaaccttttagtcttgtccttc
ttccttttgccttggcgacagtggtggtggcagcaacgacagaggcagcagcgcttaacc
atagcggaaatctacctggctaacttggcggcttccgatctggtgtttgtcctgggcctg
cccttctgggcagagaacatcgggaaccgtttcaactggcccttcggaactgacctctgc
cgggtggtcagcggggtcatcaaggccaacctgtttgtcagcatcttcctggtggtggct
atcagtcaggaccgctacaggctcctggtataccccatgaccagctgggggtaccggcgg
cgacggcaagcccaagctacgtgcctgctcatctgggtagccgggggtctcttgagcatc
cccacattccttctacgctctgttaaagtcgtccccgatctgaacgtctctgcctgcatc
ctgcttttcccccacgaggcttggcactttgcaaggatggtggagttgaacgttttgggt
ttcctcctccccgtgactgctatcatcttcttcaactatcacatcctggcctccctgaga
ggacagaaggaggccagcaggactaggtgtgggggtcccaagggcagcaagacgacgggg
ctgatcctcacactggtagcctccttcctggtctgctggtgcccttaccacttcttcgct
ttcctggatttcctggtccaggtaagagtgatccaggactgctcctggaaggagatcaca
gacctgggcctgcagctcgccaacttctttgcctttgtcaacagctgcttgaacccactg
atttatgtcttcgcaggccggctccttaagaccagggttctggggactttataa

DBGET integrated database retrieval system