KEGG   Rattus norvegicus (rat): 81511Help
Entry
81511             CDS       T01003                                 

Gene name
Lat
Definition
(RefSeq) linker for activation of T cells
  KO
K07362  linker for activation of T cells
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04064  NF-kappa B signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05135  Yersinia infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    81511 (Lat)
   04015 Rap1 signaling pathway
    81511 (Lat)
   04064 NF-kappa B signaling pathway
    81511 (Lat)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    81511 (Lat)
   04660 T cell receptor signaling pathway
    81511 (Lat)
   04658 Th1 and Th2 cell differentiation
    81511 (Lat)
   04659 Th17 cell differentiation
    81511 (Lat)
   04664 Fc epsilon RI signaling pathway
    81511 (Lat)
   04666 Fc gamma R-mediated phagocytosis
    81511 (Lat)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    81511 (Lat)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    81511 (Lat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LAT
Motif
Other DBs
NCBI-GeneID: 81511
NCBI-ProteinID: NP_110480
RGD: 620802
Ensembl: ENSRNOG00000017429
UniProt: O70601
Position
1q36
AA seq 241 aa AA seqDB search
MEADALSPVELGLLLLPFVVMLLAALCVRCRELPASYDSASTESLYPRSILIKPPQITVP
RTPATSYPLVTSFPPLRQPDLLPIPRSPQPLGGSHRMPSSRQNSDDANSVASYENQEPAR
KNVDEDEDEDDYPEGYLVVLPDSSPAAVPVVSSAPVPSNPDLGDSAFSMESCEDYVNVPE
SEESAEASLDGSREYVNVSQDAQPVIRAELASVTSQEVEDEEEEDVDGEEAPDYENLQEL
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagacgccttgagccctgtggagctgggcctcctgctgctgcccttcgtggtc
atgctcctggctgccctatgcgtgcgctgccgtgagttgccagcctcctatgacagtgct
tccacagagagtttgtacccaaggagcatcctcatcaaaccacctcaaataaccgtcccc
cgaacacctgctacttcctaccctcttgtcacttccttcccacccctgaggcagccagac
ctgctccccattccgagatccccacagcccctcgggggctcccatcggatgccatcttcc
cggcagaattcagatgatgccaacagtgtggcgagctacgagaaccaggagccagcccgt
aagaacgtggatgaagatgaggatgaagatgactatcctgagggctacctagtggtgctg
cctgacagtagtcctgctgccgtccctgttgtctcctctgctccggtgcccagcaaccct
gaccttggagacagtgccttctctatggagtcatgtgaagattacgtgaatgtccctgag
agcgaggagagtgcagaggcatctctggatgggagccgggagtatgtgaatgtgtcccag
gacgcacagccagtgatcagggctgagctggcctctgtgacctcccaggaggtggaagat
gaagaagaggaggatgtggatggagaggaagctcctgactatgagaacctgcaggaactt
aactga

DBGET integrated database retrieval system