KEGG   Rattus norvegicus (rat): 81517Help
Entry
81517             CDS       T01003                                 

Gene name
Mdk
Definition
(RefSeq) midkine
  KO
K06828  midkine
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    81517 (Mdk)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   81517 (Mdk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTN_MK_N PTN_MK_C
Motif
Other DBs
NCBI-GeneID: 81517
NCBI-ProteinID: NP_110486
RGD: 69073
Ensembl: ENSRNOG00000017560
UniProt: Q9R1S9 A9UMV0
Position
3q24
AA seq 140 aa AA seqDB search
MQHRSFFLLALVALLAVTTAVAKKKDKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGA
QTQRIHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVT
KPCTSKTKSKAKAKKGKGKD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaccgaagtttcttccttctagcccttgttgccctcttggctgtcacgaccgcg
gtggccaaaaagaaagacaaggtgaagaagggcagcgagtgttcggagtggacctggggg
ccctgcacccccagcagcaaggactgcggcatgggtttccgcgagggtacctgtggggcc
cagacccagcgcatccattgcaaggtgccctgcaactggaagaaggagtttggagccgac
tgcaaatacaagtttgagagctggggggcgtgtgatgggagcactggcaccaaagcccgc
caagggaccctgaagaaggctcggtacaatgcccagtgccaggagaccatccgcgtgacc
aagccctgcacctccaagaccaagtcaaaggccaaagccaagaaaggaaaaggaaaggac
tga

DBGET integrated database retrieval system