KEGG   Rattus norvegicus (rat): 81524Help
Entry
81524             CDS       T01003                                 

Gene name
Nf1x, Nfix
Definition
(RefSeq) nuclear factor 1 X
  KO
K09171  nuclear factor I/X
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81524 (Nf1x)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other basic domains
   NF-1
    81524 (Nf1x)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTF_NFI NfI_DNAbd_pre-N MH1
Motif
Other DBs
NCBI-GeneID: 81524
NCBI-ProteinID: NP_110493
RGD: 69080
Ensembl: ENSRNOG00000002983
UniProt: O70190 F2Z3R4 O70189
Position
19q11
AA seq 441 aa AA seqDB search
MYSPYCLTQDEFHPFIEALLPHVRAFSYTWFNLQARKRKYFKKHEKRMSKDEERAVKDEL
LGEKPEIKQKWASRLLAKLRKDIRPEFREDFVLTITGKKPPCCVLSNPDQKGKIRRIDCL
RQADKVWRLDLVMVILFKGIPLESTDGERLYKSPQCSNPGLCVQPHHIGVTIKELDLYLA
YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRVSQTPVATASG
PNFSLADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGR
SPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPG
SPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHS
QRQAPPLPTGLSASDPGTATF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtactccccgtactgcctcacccaggatgagttccacccgttcatcgaggcgctgctg
cctcacgtccgagccttctcctacacctggttcaacctgcaggcgcggaagcgcaagtac
ttcaagaagcacgagaagcggatgtcaaaggacgaggagcgcgcagtgaaggacgagctg
ctgggcgagaagcctgagatcaagcagaagtgggcatcccggctgttggccaagctgcgc
aaagacatccggcccgagttccgcgaggactttgtgctaaccatcacgggcaagaagccc
ccctgctgcgtgctctccaaccccgaccagaagggcaagatccggcggattgactgcctg
cgccaggctgacaaggtgtggcggctggacctggtcatggtgattttgtttaaagggatc
cctttggaaagtactgatggggagcggctctacaagtcgccccagtgctcgaaccccggc
ctgtgcgtccagccacatcacattggagtcacaatcaaagaactggacctttatctggct
tactttgtccacactccggaatccggacaatcagatagttcaaaccagcaaggagatgcg
gacatcaaaccactgcccaacgggcacttaagtttccaggactgctttgtgacgtctggg
gtctggaacgtgacagagctggtgagagtgtcacagactcctgttgcaactgcatcaggg
cccaacttctcactggcagatctggagagccccagttactacaacataaatcaagtgacc
ctgggacgccggtccatcacctcccctccttccaccagcaccaccaagcgccccaagtcc
atcgacgacagtgagatggagagtccagtcgatgatgtattctatcctgggacaggccgc
tccccagcagctggcagcagccagtctagcggatggcccaacgacgtggatgcaggccct
gcttctctaaagaagtcaggaaagctggacttctgcagcgccctctcctctcagggcagc
tccccacgcatggctttcacccaccacccgctgcctgtgcttgctggagtcagaccaggg
agcccccgggccacagcatcagcactgcacttcccttccacctccatcattcagcagtcg
agcccgtacttcacacacccaaccatccgctaccaccaccaccatgggcaggactcgctg
aaggagttcgtacagtttgtgtgctctgacggctcgggtcaggccaccgggcagcattca
caacgacaggcgcctcctctgccaaccggtttgtcagcatcggatcccgggacagcaact
ttctga

DBGET integrated database retrieval system