KEGG   Rattus norvegicus (rat): 81526
Entry
81526             CDS       T01003                                 

Gene name
Nov
Definition
(RefSeq) nephroblastoma overexpressed
  KO
K23571  insulin-like growth factor-binding protein 9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81526 (Nov)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    81526 (Nov)
SSDB
Motif
Pfam: TSP1_CCN IGFBP Cys_knot VWC
Other DBs
NCBI-GeneID: 81526
NCBI-ProteinID: NP_110495
RGD: 621553
Ensembl: ENSRNOG00000008697
UniProt: Q9QZQ5
Structure
PDB: 
6RK1 5NB8

Position
7q32
AA seq 351 aa
MSVFLRKQCLCLGFLLLHLLNQVSATLRCPSRCPSQCPSISPTCAPGVRSVLDGCSCCPV
CARQRGESCSEMRPCDQSSGLYCDRSADPNNETGICMVPEGDNCVFDGVIYRNGEKFEPN
CQYHCTCRDGQIGCVPRCQLDVLLPGPDCPAPKKVAVPGECCEKWTCGSEEKGTLGGLAL
PAYRPEATVGVELSDSSINCIEQTTEWSACSKSCGMGLSTRVTNRNLQCEMVKQTRLCMV
RPCEQEPGEATDMKGKKCLRTKKSLKSIHLQFKNCTSLYTYKPRFCGICSDGRCCTPFNT
KTIQVEFQCLPGQIIKKPVMVIGTCTCHSNCPQNNEAFLQELELKTSRGEM
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagcgtcttcctgcgaaagcaatgcctctgcctaggcttcctgctcctccatctctta
aatcaagtctctgcaactctgcgctgcccgtctcggtgcccgagccagtgccccagtata
tcaccgacctgcgcccccggggtgcgctcggtgctagacggctgctcctgctgtccggtg
tgcgcccgccagcgcggggagagttgctctgagatgagaccctgcgaccagagcagcggt
ctctactgcgaccgcagcgcggaccccaacaacgagactggcatttgcatggttccagag
ggagacaactgtgtgttcgatggggtcatttaccgcaatggagagaagtttgagccgaac
tgtcaataccactgcacctgcagagatgggcaaattggctgtgtgccccgctgccagctg
gatgtgcttctgccaggtcctgactgcccagctccaaaaaaagtcgcagtgcccggggag
tgttgcgaaaagtggacctgtggctcagaggagaaggggacactgggaggcctggccctt
ccagcctacagaccggaagctaccgtaggagtcgaactctctgactccagcatcaactgc
attgagcagactacagagtggagcgcgtgttccaagagctgtggaatgggcttgtccacc
cgggtcaccaacaggaatctccaatgtgagatggtaaaacagactcgtctctgcatggtt
cggccttgtgagcaagagcctggggaagcaacagacatgaaaggtaaaaagtgtctccgg
accaagaagtccctgaaatccatccacctacagttcaagaattgcactagcctgtacacc
tataagcccaggttctgtgggatctgcagtgacgggcgctgctgtacgcccttcaatacc
aaaaccatccaggtggagtttcagtgtttgccagggcaaatcatcaaaaaaccagtcatg
gtcattggaacctgtacctgccactccaactgccctcagaacaatgaggccttcctccaa
gagctggagctgaagacgagcagaggagaaatgtaa

DBGET integrated database retrieval system