KEGG   Rattus norvegicus (rat): 81531
Entry
81531             CDS       T01003                                 

Gene name
Pfn2
Definition
(RefSeq) profilin 2
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    81531 (Pfn2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81531 (Pfn2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81531 (Pfn2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81531 (Pfn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81531 (Pfn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81531 (Pfn2)
   04147 Exosome [BR:rno04147]
    81531 (Pfn2)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    81531 (Pfn2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     81531 (Pfn2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   81531 (Pfn2)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 81531
NCBI-ProteinID: NP_110500
RGD: 621826
Ensembl: ENSRNOG00000017427
UniProt: Q9EPC6
Position
2q26
AA seq 149 aa
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFF
TNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSWVLAARQTVKY
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcatcacgccagcagaaatagatgtgattataggaaaagaccgggaaggtttcttt
accaatggtttgactcttggaggaaagaagtgctctgtgatcagagatagcctatacgtt
gactcggactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac
gttgctgttggcagagctgggagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactcttgggtt
ctagctgctaggcagactgttaagtattag

DBGET integrated database retrieval system