KEGG   Rattus norvegicus (rat): 81613
Entry
81613             CDS       T01003                                 

Gene name
Ceacam1, BGPR, Bgp, CD66a, Ccam1
Definition
(RefSeq) carcinoembryonic antigen related cell adhesion molecule 1
  KO
K06499  carcinoembryonic antigen-related cell adhesion molecule
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81613 (Ceacam1)
   04090 CD molecules [BR:rno04090]
    81613 (Ceacam1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    81613 (Ceacam1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   81613 (Ceacam1)
  Exosomal proteins of bladder cancer cells
   81613 (Ceacam1)
CD molecules [BR:rno04090]
 Proteins
  81613 (Ceacam1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  81613 (Ceacam1)
SSDB
Motif
Pfam: Ig_3 Ig_2 V-set ig I-set Ig_4 Ig_5 Ig_6 Adeno_E3_CR1
Other DBs
NCBI-GeneID: 81613
NCBI-ProteinID: NP_001029032
RGD: 67396
Ensembl: ENSRNOG00000020578
UniProt: P16573
Position
1q21
AA seq 519 aa
MELASARLLRGQIPWRGLLLTASLLTYWSPLTTAQVTVDAVPPNVVEEKSVLLLAHNLPQ
EFQVFYWYKGTTLNPDSEIARYIRSDNMSKTGPAYSGRETIYSNGSLFFQNVNKTDERAY
TLSVFDQQFNPIQTSVQFRVYPALQKPNVTGNNSNPMEGEPFVSLMCEPYTNNTSYLWSR
NGESLSEGDRVTFSEGNRTLTLLNVRRTDKGYYECEARNPATFNRSDPFNLDVIYGPDAP
VISPPDIYLHQGSNLNLSCHADSNPPAQYFWLINEKLQTSSQELFISNITTNNSGTYACF
VNNTVTGLSRTTVKNITVFEPVTQPSIQITNTTVKELGSVTLTCFSKDTGVSVRWLFNSQ
SLQLTDRMTLSQDNSTLRIDPIKREDAGDYQCEISNPVSFRISHPIKLDVIPDPTQGNSG
LSEGAIAGIVIGSVAGVALIAALAYFLYSRKTGGGSDHRDLTEHKPSTSSHNLGPSDDSP
NKVDDVSYSVLNFNAQQSKRPTSASSSPTETVYSVVKKK
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggagctagcctcggctcgtctcctcagagggcagattccctggaggggactactgctc
acagcctcacttttaacctactggagccctctcaccactgcccaagtcaccgtagacgct
gtgccacccaacgttgttgaggagaagagcgttcttttactcgctcacaatctgccgcag
gagttccaagtcttttactggtacaagggaaccactttgaatccagacagtgaaattgca
cgatatataagatccgataatatgagtaaaacaggacctgcatacagcggcagagagaca
atatacagcaatggatccttgttcttccaaaatgtcaacaagactgacgagagagcctac
acactatctgtgtttgatcaacaatttaatcctatacaaacgtctgtgcaatttcgtgta
taccccgcattacaaaagcccaacgtcacaggtaacaactccaatcccatggagggtgag
cccttcgtatcattaatgtgtgaaccgtacactaacaataccagctacctgtggagcaga
aatggtgaaagcctctcagaaggtgacagggtgacgttctctgagggcaacaggactctc
actttactcaacgtcaggaggactgacaaaggatactatgagtgtgaagcccggaaccca
gcgactttcaatcgaagtgacccattcaacctggacgttatctatggtccggacgcccca
gttatatcccctccagatatttatttgcatcaagggtcaaacctcaacctctcctgccat
gcagactctaaccctcccgcacagtacttttggcttatcaatgagaagctccagacatcc
tcccaagagctctttatctccaacatcactactaacaatagcggaacctatgcctgcttc
gtcaataacactgtcactggcctcagtcgcaccacagtcaagaacattacagtctttgag
ccagtgactcagccctccatccaaatcaccaacaccacagtcaaagaactaggctctgtg
accctgacctgcttctcaaaggacactggagtctccgtccgatggcttttcaatagccag
agtctgcagctcacagacaggatgacgctctcccaggacaacagcaccctcagaatagac
cctattaagagagaagatgccggggactatcagtgtgagatctccaacccggtcagtttc
aggataagtcacccaatcaagctggacgtaatacctgatccaacacaaggaaattctggc
ctctcagagggtgccattgcaggcattgtgattggatctgtggctggagtggccctaata
gcagcgctggcatacttcctttattccaggaagactggcgggggaagtgaccatcgagat
ctcacagagcacaaaccctcaacctccagccacaatctgggtccttctgacgactctcct
aacaaggtggatgacgtctcatactctgtcctgaacttcaatgcccagcaatccaaacga
ccaacttcagcctcttcaagccccacagaaacagtttattcggtagtcaaaaagaagtga

DBGET integrated database retrieval system