KEGG   Rattus norvegicus (rat): 81633
Entry
81633             CDS       T01003                                 

Gene name
Acta2
Definition
(RefSeq) actin, aortic smooth muscle
  KO
K12313  actin, aortic smooth muscle
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    81633 (Acta2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    81633 (Acta2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81633 (Acta2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81633 (Acta2)
   04147 Exosome [BR:rno04147]
    81633 (Acta2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     81633 (Acta2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   81633 (Acta2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 81633
NCBI-ProteinID: NP_112266
RGD: 621676
Ensembl: ENSRNOG00000058039
UniProt: P62738 B0BMT0
Position
1
AA seq 377 aa
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgaagaggaagacagcacagctctggtgtgtgacaatggctccgggctctgtaag
gcgggctttgctggtgatgatgctcccagggctgttttcccatccatcgtgggacgtccc
agacaccagggagtgatggttggaatgggccaaaaggacagctatgtgggggacgaagcg
cagagcaagagagggatcctgaccctgaagtatccgatagaacacggcatcatcaccaac
tgggacgacatggaaaagatctggcaccactccttctataacgagcttcgcgtggcccca
gaggagcatccgaccttgctaacggaggcgccgctgaaccctaaggccaaccgggagaaa
atgacccagattatgtttgagaccttcaatgtccctgccatgtatgtggctattcaggct
gtgctgtccctctatgcttctggacgtacaactggtattgtgctggactctggagatggc
gtgactcacaacgtgcctatctatgagggctatgctctgcctcatgccatcatgcgtctg
gacttggctggccgagatctcaccgactacctcatgaagatcctgactgagcgtggctat
tccttcgtgactactgctgagcgtgagatcgtccgtgacatcaaggagaagctgtgctat
gtcgctctggactttgaaaatgagatggccactgctgcttcctcttcttccctggagaag
agctacgaactgcctgatgggcaggtgatcaccatcgggaatgaacgcttccgctgcccg
gagaccctcttccagccatctttcattggaatggagtcggcgggcatccacgaaaccacc
tataacagcatcatgaagtgtgatattgacatcaggaaggacctctatgctaacaacgtc
ctctcggggggcactaccatgtacccaggcattgctgacaggatgcagaaggagatcaca
gccctcgctcccagcaccatgaagatcaagattattgctcctccagaacgcaaatattct
gtctggatcggcggctccatcctggcttctctatctaccttccagcagatgtggatcagc
aaacaggagtatgacgaagctggcccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system