KEGG   Rattus norvegicus (rat): 81638Help
Entry
81638             CDS       T01003                                 

Gene name
Agtr1b, AT1, AT1B, AT3, AT<sub>1</sub>R, Agtr1
Definition
(RefSeq) angiotensin II receptor, type 1b
  KO
K04166  angiotensin II receptor type 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04614  Renin-angiotensin system
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    81638 (Agtr1b)
   04020 Calcium signaling pathway
    81638 (Agtr1b)
   04072 Phospholipase D signaling pathway
    81638 (Agtr1b)
   04022 cGMP-PKG signaling pathway
    81638 (Agtr1b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81638 (Agtr1b)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    81638 (Agtr1b)
   04614 Renin-angiotensin system
    81638 (Agtr1b)
   04925 Aldosterone synthesis and secretion
    81638 (Agtr1b)
   04927 Cortisol synthesis and secretion
    81638 (Agtr1b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81638 (Agtr1b)
   04270 Vascular smooth muscle contraction
    81638 (Agtr1b)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    81638 (Agtr1b)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    81638 (Agtr1b)
   04934 Cushing syndrome
    81638 (Agtr1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81638 (Agtr1b)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    81638 (Agtr1b)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    81638 (Agtr1b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Angiotensin
    81638 (Agtr1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 81638
NCBI-ProteinID: NP_112271
RGD: 2071
Ensembl: ENSRNOG00000010640
UniProt: P29089
Position
2q24
AA seq 359 aa AA seqDB search
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacccttaactcctctactgaagatggaattaaaagaatccaagatgactgccccaag
gctggcaggcacaattacatatttgtcatgatccctactctctacagcatcatctttgtg
gtgggaatatttggaaacagcttggtggtgattgtcatttacttttacatgaagctaaag
actgtggccagtgtttttcttctgaatcttgccctggctgatttatgctttttgttgact
ttgccactgtgggcagtctataccgctatggaataccgatggcccttcggcaaccaccta
tgtaagatcgcttctgccagcgtcagtttcaatctctatgccagtgtgtttctgctcacg
tgtctcagcatcgatcgctacctggccattgtccacccaatgaagtctcgcctccgccgc
acgatgctggtagccaaagtcacctgcatcatcatctggctaatggctggcttggccagt
ttgccagccgtcatctaccgaaacgtatatttcatcgagaacaccaatatcacagtttgc
gcttttcattatgaatctcagaactcaacactccccattggactgggtctaacaaagaac
attctgggcttcgtgttccctttccttatcattctcaccagctatactcttatttggaaa
gccctaaagaaggcttataaaattcagaagaacacgccaagaaatgatgacatctttagg
ataattatggcgattgtgcttttcttcttcttttcctgggttccccaccaaatattcact
tttctggatgtgctcattcagctgggcattatccgtgactgtgaaattgctgacattgtg
gacaccgctatgcccatcaccatctgcatagcttattttaacaattgcctgaatcctctg
ttttatggctttctggggaaaaaatttaaaaaatatttcctccagcttctgaaatacatt
cccccaacggccaagtcacacgcaggcttgtcaacaaaaatgagcactctttcctaccgc
ccttcagataacatgagttcatctgccaaaaagtctgcatctttttttgaagtggagtga

DBGET integrated database retrieval system