KEGG   Rattus norvegicus (rat): 81640Help
Entry
81640             CDS       T01003                                 

Gene name
Amd1, Amd1a, Amd1b
Definition
(RefSeq) adenosylmethionine decarboxylase 1
  KO
K01611  S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
rno_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    81640 (Amd1)
   00330 Arginine and proline metabolism
    81640 (Amd1)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     81640 (Amd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_decarbox
Motif
Other DBs
NCBI-GeneID: 81640
NCBI-ProteinID: NP_112273
RGD: 2104
Ensembl: ENSRNOG00000000585
UniProt: P17708
Position
20q12
AA seq 333 aa AA seqDB search
MEAAHFFEGTEKLLEVWFSRQQSDASQGSGDLRTIPRSEWDVLLKDVQCSIISVTKTDKQ
EAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKP
SHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDLPESRVINQPDQTLEIL
MSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATLFNPCGYSMNGMKSDGTYW
TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLSSPQ
KIDGFKRLDCQSAMFNDYNFVFTSFAKKQQQQS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcacattttttcgaagggaccgagaaactgctggaggtctggttctccaga
cagcagtccgacgcaagccagggatctggggaccttcgtaccatcccaagatccgagtgg
gatgtccttctgaaggatgtgcagtgctcaatcataagtgtgacaaagactgacaagcag
gaagcttatgtactcagtgagagtagcatgtttgtctccaagagacgtttcattttgaag
acatgtggtaccaccctcttactgaaagcactggttcccctgttgaagcttgctagggac
tacagtgggtttgactcgattcaaagcttcttttattctcgtaagaatttcatgaagcct
tctcaccaagggtacccacaccggaatttccaggaagaaatcgagtttcttaatgcaatt
ttcccaaacggagcagcatattgtatgggacgtatgaattctgactgttggtacctgtac
actttggatctcccagagagccgagtaatcaatcagccagatcaaaccctggaaattctg
atgagtgagcttgacccagcagttatggaccagttctacatgaaagatggtgttactgca
aaggatgtcactcgtgagagtggaattcgtgacctgataccaggttctgtcattgatgcc
acactgttcaatccttgtggctactcaatgaatggaatgaaatcggatggaacatattgg
actattcacatcactccagaaccagaattttcttatgttagctttgaaacaaacctaagt
cagacctcctatgacgacctgatcaggaaagttgtggaagtcttcaagccaggaaaattt
gtgaccaccttgtttgttaatcagagttctaagtgtcgcacagtgctttcttcgccccag
aagattgacggtttcaaacgtcttgattgccagagcgctatgttcaacgattacaatttt
gtttttaccagttttgctaagaaacagcaacaacagagttga

DBGET integrated database retrieval system