KEGG   Rattus norvegicus (rat): 81641Help
Entry
81641             CDS       T01003                                 

Gene name
Anpep, AP-M, AP-N, Apm, Apn, KZP, Lap1, rAPN
Definition
(RefSeq) alanyl aminopeptidase, membrane
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
rno04614  Renin-angiotensin system
rno04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    81641 (Anpep)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    81641 (Anpep)
  09152 Endocrine system
   04614 Renin-angiotensin system
    81641 (Anpep)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81641 (Anpep)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81641 (Anpep)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81641 (Anpep)
   04090 CD molecules [BR:rno04090]
    81641 (Anpep)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     81641 (Anpep)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M1
   81641 (Anpep)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    81641 (Anpep)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   81641 (Anpep)
CD molecules [BR:rno04090]
 Proteins
  81641 (Anpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERAP1_C Peptidase_M1 Peptidase_M1_N HRG
Motif
Other DBs
NCBI-GeneID: 81641
NCBI-ProteinID: NP_112274
RGD: 2991
Ensembl: ENSRNOG00000014610
UniProt: P15684
Position
1q31
AA seq 965 aa AA seqDB search
MAKGFYISKTLGILGILLGVAAVCTIIALSVVYAQEKNRNAENSAIAPTLPGSTSATTST
TNPAIDESKPWNQYRLPKTLIPDSYQVTLRPYLTPNEQGLYIFKGSSTVRFTCNETTNVI
IIHSKKLNYTNKGNHRVALRALGDTPAPNIDTTELVERTEYLVVHLQGSLVKGHQYEMDS
EFQGELADDLAGFYRSEYMEGGNKKVVATTQMQAADARKSFPCFDEPAMKASFNITLIHP
NNLTALSNMLPKDSRTLQEDPSWNVTEFHPTPKMSTYLLAYIVSEFKYVEAVSPNRVQIR
IWARPSAIDEGHGDYALQVTGPILNFFAQHYNTAYPLEKSDQIALPDFNAGAMENWGLVT
YRESALVFDPQSSSISNKERVVTVIAHELAHQWFGNLVTVDWWNDLWLNEGFASYVEFLG
ADYAEPTWNLKDLIVLNDVYRVMAVDALASSHPLSSPANEVNTPAQISELFDSITYSKGA
SVLRMLSSFLTEDLFKKGLSSYLHTFQYSNTIYLDLWEHLQQAVDSQTAIKLPASVSTIM
DRWILQMGFPVITVNTSTGEIYQEHFLLDPTSKPTRPSDFNYLWIVPIPYLKNGKEDHYW
LETEKNQSAEFQTSSNEWLLLNINVTGYYQVNYDENNWRKIQNQLQTDLSVIPVINRAQI
IHDSFNLASAGKLSITLPLSNTLFLASETEYMPWEAALSSLNYFKLMFDRSEVYGPMKRY
LKKQVTPLFAYFKIKTNNWLDRPPTLMEQYNEINAISTACSSGLEECRDLVVGLYSQWMN
NSDNNPIHPNLRSTVYCNAIAFGGEEEWNFAWEQFRKATLVNEADKLRSALACSNEVWIL
NRYLSYTLNPDYIRKQDATSTIVSIANNVVGQTLVWDFVRSNWKKLFEDYGGGSFSFANL
IQGVTRRFSSEFELQQLEQFKEDNSATGFGSGTRALEQALEKTKANIKWVKENKDVVLKW
FTENS
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggccaagggtttctacatttccaagaccctgggcatcttgggcatcctgttaggtgtg
gcagccgtatgcaccatcatagctctgtcggtggtctacgctcaggagaagaacaggaat
gcggagaactctgccatagcccccacgctcccaggcagcacctcagccaccacctcaact
accaaccctgctatagatgaaagcaaaccttggaaccagtatcgcttgcctaagactctt
atacccgactcctaccaggtgaccttgaggccttacctcacccccaacgagcagggcctg
tacatcttcaaaggttccagtactgtccgctttacctgcaacgagaccacaaatgtcatc
attatccacagcaagaagctcaactacaccaacaaagggaaccacagggtggcgttgcga
gccctgggtgacactccggcacctaacatcgacacaacggaactggtagagcgcacggag
tacctggtggtgcacctgcagggctccctggtaaagggccatcagtacgagatggacagt
gagttccagggggagctggctgatgatctggctggcttctaccgcagcgagtacatggaa
ggtggcaacaagaaagtggtggccaccacacagatgcaggctgccgatgctcgaaaatcc
tttccttgcttcgatgagccagccatgaaggcctcattcaacatcacgctcatccacccc
aacaacctcaccgctctgtctaacatgcttcccaaagattccaggacccttcaggaagat
ccttcctggaacgtcactgagttccaccctaccccgaagatgtccacatacctgctggcc
tatatcgtgagcgagttcaaatatgtagaagccgtctcacccaatagagtccagattcga
atctgggctcggcccagtgccattgatgagggccatggtgattacgctctgcaagtcaca
ggccctatcctaaacttctttgcccaacattataatacagcctaccctctagaaaaatct
gaccagattgccctgcctgacttcaacgctggagccatggagaactgggggctcgtgacc
taccgagagagtgccctggtctttgaccctcagtcctcctccattagcaacaaggagcgg
gtggtcactgtgattgcccatgagctggcccatcagtggtttggcaacctggtgaccgtg
gattggtggaatgacctgtggctgaacgagggctttgcctcctatgtggaatttctgggt
gctgactatgcagagcccacctggaatctgaaagacctcatagtactgaatgatgtgtac
cgtgtgatggccgtggacgcgctcgcttcctcccacccgttgtccagccctgccaacgag
gtcaacacgccagcccagatcagtgagctgtttgacagcatcacctacagcaagggagcc
tcagtccttaggatgttgtccagcttcctgacagaggacctgttcaagaagggcctttcg
tcttacctccacaccttccaatactcgaacaccatttatctggacctgtgggaacacctt
cagcaggcagtggacagtcagacagctatcaaactcccagcctcagtgagcaccatcatg
gaccgatggattctacagatgggttttcctgttatcactgtgaacaccagtacgggagaa
atctaccaggaacacttcctcctggaccccacttccaaacctacccgcccctcagatttt
aattacctctggattgtgcccattccgtatctcaaaaatggaaaggaggatcactactgg
ctggagaccgagaaaaaccagagtgcagaattccaaacatcctccaatgaatggctctta
ctgaacattaatgtaaccggctactaccaggttaactatgatgaaaacaactggaggaag
attcagaatcagctgcaaacagacctttctgttatccctgtcatcaaccgtgcgcagatt
atccacgactccttcaacctagccagtgctggaaagctatccatcactctgccgctgagc
aacaccctcttcctggccagtgaaacagaatacatgccctgggaggctgccctgagcagc
ctgaactacttcaagctcatgtttgaccgctcggaggtctacggccccatgaagcgctat
ctgaagaagcaagtcacacccctcttcgcctacttcaaaatcaaaaccaacaactggctc
gaccgtcctccaacactgatggagcagtacaacgaaattaatgccatcagcaccgcctgt
tctagtggtctcgaagagtgtagggatctcgttgttgggctttatagtcagtggatgaac
aactctgataataacccgatccaccccaaccttcggtctactgtctactgcaatgccatt
gctttcggtggtgaggaagagtggaactttgcttgggaacagttccggaaagcaactctg
gtgaacgaggcagataaactccgctcagccttggcctgtagcaacgaggtgtggattttg
aacaggtacctgagttacactctgaaccccgactacatccggaagcaggatgctacctcc
accatcgtcagcatcgccaacaacgtggttggacaaactctagtttgggactttgtccga
agcaactggaagaaactgtttgaagattacggcggaggatctttctcctttgccaatctc
atccagggagtgacccggcgcttctcctctgagttcgagctgcagcagctggagcagttt
aaagaggacaactcggccacaggctttggctccggcactcgggctctggagcaagccctg
gagaagactaaagccaacatcaagtgggtgaaggagaacaaagacgtggtactcaagtgg
ttcacagaaaacagctag

DBGET integrated database retrieval system