KEGG   Rattus norvegicus (rat): 81642
Entry
81642             CDS       T01003                                 

Gene name
Abcc6, Mrp6
Definition
(RefSeq) ATP binding cassette subfamily C member 6
  KO
K05669  ATP-binding cassette, subfamily C (CFTR/MRP), member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    81642 (Abcc6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    81642 (Abcc6)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    81642 (Abcc6)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 AAA_16 AAA_21 AAA_29 RsgA_GTPase AAA_22 AAA_25 Dynamin_N
Other DBs
NCBI-GeneID: 81642
NCBI-ProteinID: NP_112275
RGD: 620268
Ensembl: ENSRNOG00000028781
UniProt: O88269
Position
1q22
AA seq 1502 aa
MNGEHSMATPGESCAGLRVWNQTEQEPVAYHLLNLCFLRAAGSWVPPMYLWVLGPIYLLY
IHRHGCCYLRMSRLFKIKMVLGFALILLYTFNAAVPLWRIHRGMPQAPELLIHPTVWLTT
MSFATFLIHMERKKGVRASGLLFGYWLLCCLVPAIDTVQQASAGSFRQEPLHHLATYLCL
SLVVAELVLSCLVDQPPFFSEDSKPLNPCPEAEASFPSKAMFWWASGLLWKGYRKLLGPK
DLWSLERENSSEELVSQLEREWRRNFSELPGHKGHSGMGTPETEAFLQPERSQRGPLLRA
IWRVFRSTFLLGTLSLVISDAFRFAVPKLLSLFLEFMGDLESSAWTGWLLAVLMFLSACL
QTLFEQQYMYRVKVLQMRLRTAITGLVYRKVLVLSSGSRKSSAAGDVVNLVSVDVQRLVE
SILHLNGLWLLFLWIIVCFVYLWQLLGPSALTAVAVFLSLLPLNFFITKKRSFHQEEQMR
QKASRARLTSSMLRTVRTIKSHGWECAFLERLLHIRGQELGALKTSAFLFSVSLVSFQVS
TFLVALVVFAVHTLVAEDNAMDAEKAFVTLTVLSILNKAQAFLPFSVHCLVQARVSFDRL
AAFLCLEEVDPNGMVLSPSRCSSKDRISIHNGTFAWSQESPPCLHGINLTVPQGCLLAVV
GPVGAGKSSLLSALLGELLKVEGSVSIEGSVAYVPQEAWVQNTSVVENVCFRQELDLPWL
QEVLEACALGSDVASFPAGVHTPVGEQGMNLSGGQKQRLSLARAVYRRAAVYLMDDPLAA
LDAHVSQEVFKQVIGPSGLLQGTTRILVTHTLHVLPQADQILVLANGTIAEMGSYQDLLH
RNGALVGLLDGARQPAGEGEGEAHAAATSDDLGGFSGGGTPTRRPERPRPSDAAPVKGST
SEAQMEPSLDDVEVTGLTAGEDSVQYGRVKSATYLSYLRAVGTPLCTYTLFLFLCQQVAS
FCQGYWLSLWADDPVVDGKQMHSALRGSIFGLLGCLQAIGLFASMAAVFLGGARASCLLF
RSLLWDVARSPIGFFERTPVGNLLNRFSKETDIVDVDIPDKMRTLLTYAFGLLEVGLAVS
MATPLAIVAILPLMLLYAGFQSLYVATCCQLRRLESASYSSVCSHLAETFQGSQVVRAFQ
AQGPFTAQHDALMDENQRISFPRLVADRWLAANLELLGNGLVFVAATCAVLSKAHLSAGL
AGFSVSAALQVTQTLQWVVRSWTDLENSMVAVERVQDYVHTPKEAPWRLPSSAAQPLWPC
GGQIEFRDFGLRHRPELPMAVQGVSLKIHAGEKVGIVGRTGAGKSSLTWGLLRLQEATEG
GIWIDGVPITDMGLHTLRSRITIIPQDPVLFPGSLRMNLDLLQENTDEGIWAALETVQLK
AFVTSLPGQLQYECSGQGDDLSVGQKQLLCLARALLRKTQILILDEATASVDPGTEIQMQ
AALERWFAQCTVLLIAHRLRSVMNCARVLVMDEGQVAESGSPAQLLAQKGLFYRLAQESG
LA
NT seq 4509 nt   +upstreamnt  +downstreamnt
atgaacggagagcactcaatggccacgcctggagagtcctgcgcaggcctgagggtctgg
aaccagacagaacaggagcctgtggcctatcacttgctcaacctgtgcttcctgcgagcc
gccgggagctgggtgccccccatgtacctctgggtccttggccccatctacctcctctac
atccatcgccatggctgctgctacctccggatgtcccgcctcttcaaaatcaaaatggtg
ctcggctttgccctcatccttctctacaccttcaacgcggccgtgcctctctggaggatc
caccggggcatgccccaggccccagagcttctcattcaccctaccgtgtggctcaccacc
atgagcttcgccaccttcctgatccacatggagagaaagaagggggtccgtgcatctggg
ttgttgttcgggtactggctgctctgctgcctcgtgccagccatcgacactgtccagcag
gcctccgcagggagcttccgccaggagcccctccaccacctggccacctacctgtgcttg
tccctggtggtggcagagctggtgctgtcttgtctggtagaccagccacccttcttctcg
gaagactccaagccattgaatccatgtccagaggccgaggcctcttttccctccaaggcc
atgttctggtgggcctctggactgctatggaagggctacaggaaactgctggggccaaaa
gacctctggtcacttgagagagaaaactcttcagaagaacttgtttcccagctggaaaga
gaatggaggaggaacttcagtgagctgccggggcacaaagggcacagtggtatggggacc
cccgagacagaggccttcctgcagccagagaggagccagcggggcccgctgctcagggct
atctggcgtgtgttccggtccactttcctgctggggaccctcagcctggtcattagcgat
gccttcaggtttgctgttcccaagctcctcagtctgtttctggagttcatgggcgacctc
gagtcctcggcttggacgggctggctcctggctgtgctgatgttcttgtcggcctgccta
cagacactgtttgaacagcagtacatgtacagagtcaaggtcctgcagatgaggctgcga
acagccatcactggcctggtgtacagaaaggtcctggtcctgtccagtggttccagaaag
tccagtgcagcaggggacgtggtcaacctggtgtcagtggacgtacagcggctggtcgag
agcatcctccacctcaacgggctgtggctgctcttcctgtggatcattgtgtgctttgtc
tacctgtggcagctccttgggccctctgccctcacagccgttgctgtcttcctgagcctt
ctccccctgaacttcttcattaccaagaagaggagcttccatcaggaagaacagatgagg
cagaaggcctcccgagcacggctcaccagctccatgctcagaactgtgagaaccatcaag
tcccacggctgggagtgtgccttcctggagcgactcctgcatatccggggccaggagcta
ggtgccctgaagacctccgccttcctcttctctgtgtctctcgtgtccttccaagtgtct
acatttctggtggcgctggttgtgtttgctgtccacaccctggtggcagaggacaacgcc
atggatgcggagaaggcgtttgtgacgctcacggtgctcagcatccttaacaaagcccag
gccttcctccccttctctgtgcactgcctcgttcaggctcgggtgtcctttgaccgccta
gctgctttcctgtgcctggaagaagtagaccccaatggcatggtcttgagtccctccaga
tgctcctcgaaggatcgaatttctatacacaatggcaccttcgcttggtcccaggagagc
ccgccctgcctgcacgggatcaacctcaccgtgccccagggctgtctgctggctgttgtg
ggtccagtgggggctggaaagtcctccctgctgtctgccctgcttggggagctgttgaag
gtagaagggtctgtgagcattgagggttccgtggcctacgtgcctcaggaggcttgggtc
cagaatacctctgtggtggagaatgtgtgcttcaggcaggagctggatctgccatggttg
caggaagttctagaagcctgtgccttggggtctgatgtggccagcttccctgcaggagtt
cacaccccagtaggggagcagggcatgaatctttctgggggccagaagcagcggctgagc
ttggctcgggctgtgtacagaagggctgctgtgtacctgatggatgaccccctagcagcc
ctggatgcgcatgtcagccaggaagtcttcaaacaggtcattggccccagtggacttctc
caaggtacgactcggatccttgtaacacacacgctgcatgtcctgccccaagctgaccag
atcctggtgctggccaatgggaccatcgcagagatgggctcctaccaagaccttctgcat
aggaacggagccctggtgggtcttctggatggagccagacagcctgcaggcgaaggagaa
ggagaagcacatgctgcagccaccagtgatgaccttggaggcttttctggaggtgggacg
cccacgcgcagaccagagaggcccagacccagtgacgcagcccctgtgaagggcagtact
tcagaggcacagatggagccttctctggatgacgttgaggtcactggactgacagcagga
gaggacagtgtgcagtatggccgggtgaagagcgccacatacctgagctacctgcgggcg
gtgggcacaccgctctgcacctacaccctgttcctcttcctctgccagcaagtggcgtcc
ttctgccaaggctactggctgagcctctgggccgacgacccggtcgtggatgggaagcag
atgcattcagccctgcgtggctccatctttggactccttggctgtctgcaagccatcgga
ctgtttgcctccatggctgcggtgttcctgggtggagcccgagcttcatgcctgcttttc
cggagcctcctctgggacgtggctcgctctcccattggcttctttgagcgcacaccagtc
gggaacctgctgaaccgtttttccaaggagacggacatagtggatgtggacatcccagac
aagatgaggaccctgctgacctatgcctttggactcctggaggttggcctggcagtgtcg
atggccacaccactggctattgtggccatcctacctcttatgctcctttatgctgggttt
cagagcctctacgtggccacatgttgccagctgagacgcctggagtcggccagttactcc
tcagtgtgttcccatctggctgagaccttccagggcagtcaggtggtcagggccttccag
gcccaggggcccttcacagctcagcacgatgccctcatggatgagaaccagaggatcagt
ttcccgaggctggtggctgacaggtggctggctgccaacctggagctcctggggaatggc
ctggtgtttgtggccgctacatgtgctgtgctgagcaaggctcacctgagtgctggcctc
gcgggcttctcggtttctgctgccctccaggtaacacagactctgcagtgggtggtccgc
agctggacagatctggagaacagcatggtggccgtggagcgagtacaggactacgttcac
acccccaaggaggctccctggaggctgccctcctctgcagcccagcctctctggccctgt
gggggacagattgagttccgagactttgggctcagacaccgaccagagctgcccatggct
gtgcagggtgtgtccctgaagatccatgcaggggagaaggtgggcatcgtgggcaggaca
ggggccgggaagtcctccctgacttggggcctgctgcggcttcaggaggccactgagggt
ggtatttggatcgatggggtccccatcaccgacatggggctgcacacactgcggtccaga
atcaccatcatccctcaggaccctgtcctgttcccgggctcgctgcggatgaacctggac
ctgcttcaggagaacacagatgagggcatctgggcagcgctggagacggtgcagctcaag
gccttcgtgaccagcctgcctggccagctgcagtatgagtgctcaggccagggagatgac
ctgagtgtgggtcagaagcagctcctgtgtctggcacgtgcccttctccggaaaacccag
atcctcatcctggatgaagccactgcctccgtggacccagggacggagatacagatgcag
gcggccctcgagcgctggtttgcacagtgtacagtgctgctcattgctcaccgcctgcgc
tccgtgatgaactgcgccagggttctagtcatggatgaggggcaggtggcagagagtggc
agtccagcacagctgctggcccagaaaggcctgttttacaggctagcccaggagtcgggc
ctagcctga

DBGET integrated database retrieval system