KEGG   Rattus norvegicus (rat): 81643Help
Entry
81643             CDS       T01003                                 

Gene name
Atic
Definition
(RefSeq) 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00670  One carbon pool by folate
rno01100  Metabolic pathways
rno01523  Antifolate resistance
Module
rno_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    81643 (Atic)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    81643 (Atic)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    81643 (Atic)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81643 (Atic)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     81643 (Atic)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     81643 (Atic)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81643 (Atic)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AICARFT_IMPCHas MGS
Motif
Other DBs
NCBI-GeneID: 81643
NCBI-ProteinID: NP_112276
RGD: 70879
Ensembl: ENSRNOG00000015511
UniProt: O35567
Position
9q33
AA seq 592 aa AA seqDB search
MASSQLALFSVSDKTGLVEFARNLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLIRVVVCNLYPFVKTVASPDVTVEAA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYGAVAAEMQGSGNKDTSLETRRHLALKAFT
HTAQYDEAISDYFRRQYSKGISQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINL
CDALNAWQLVTELRGAVDIPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLA
IAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNG
SYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKA
GVKRAEVSNAIDQYVTGTIGEGEDLVKWKALFEEVPELLTEAEKKEWVDKLSGVSVSSDA
FFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcccagcttgccctgttcagtgtgtctgacaaaactggcctcgtggaattt
gccagaaacctcgcgtctcttggtttgagtttggtcgcttctggaggcacggcaaaagcg
atcagggatgctggcctggcagtgagagatgtgtctgagctaactgggttccctgaaatg
ttaggggggcgtgtgaaaaccttgcatcctgcagtccatgctggaatcttagcacgcaat
attccagaagatgctgctgacatggccaggcttgatttcaacctcataagagttgttgtc
tgtaacctgtacccgttcgtgaagactgtggcttctccagatgtaaccgttgaggcagct
gttgagcaaattgacattggtggcgtgaccttactgagagctgcagccaaaaaccatgct
cgagtgacagttgtgtgtgagccagaggactatggtgcggtggctgcagagatgcagggc
tctggtaataaggacacctccctggagaccaggcgccacttggcattgaaggcattcacg
cataccgctcaatatgatgaagcgatttcggattacttcaggagacagtacagtaaagga
atttctcagatgcccttgaggtatgggatgaacccccatcagactcctgcccagctgtat
acactgaagcccaagcttcccatcacagttctcaacggagccccaggattcataaacctc
tgcgatgctttgaatgcctggcagctggtgacagagctgagaggagcagtagacattcca
gctgcggcgtctttcaagcacgtcagcccagcaggtgctgctgttggggttccactcagt
gaggacgaagccagagtctgcatggtctatgacctctatccgaccctcacgcccctggcc
attgcatatgcaagagcaagaggagctgataggatgtcttcatttggtgattttgttgca
ttatctgatgtttgtgatgtcccaactgcaaaaattatctccagagaagtgtcagatggt
attgttgccccaggatatgaggaagaggccttgaaaatactttctaaaaagaaaaatgga
agctactgtgttcttcagatggaccagtcctacaaaccggatgaaaatgaagttcgaacg
ctctttggtcttcgtttaagccagaagagaaataatggtgttgttgacaagtcgttgttt
agcaatattgtcaccaagaataaagatctgccggaatctgctctccgagacctcattgtc
gccaccatcgctgtcaagtatactcagtctaattcggtgtgctatgccaaggacgggcag
gttattggcatcggagcaggacagcagtctcggatacactgtacacgccttgcaggtgat
aaggcaaactcttggtggcttcggcaccatccacgagtgctttccatgaagtttaaagct
ggggtgaagagagcagaagtctccaatgccatcgatcagtatgtgaccggcaccattggt
gagggtgaagacctggtgaaatggaaagcactgtttgaagaggttcctgagttactcact
gaggcggagaagaaggaatgggtggacaagctgagtggcgtgtctgtcagttccgatgct
ttctttcctttcagggataatgtagaccgagcgaaaaggagtggtgtggcctacattgtt
gctccatccggatctactgctgacaaggttgtgatcgaggcgtgtgacgagctggggatc
gtgttggctcatacagatctgcgtctcttccaccactga

DBGET integrated database retrieval system