KEGG   Rattus norvegicus (rat): 81645Help
Entry
81645             CDS       T01003                                 

Gene name
Chrm2, Acm2
Definition
(RefSeq) cholinergic receptor, muscarinic 2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04725  Cholinergic synapse
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    81645 (Chrm2)
   04024 cAMP signaling pathway
    81645 (Chrm2)
   04151 PI3K-Akt signaling pathway
    81645 (Chrm2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81645 (Chrm2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81645 (Chrm2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    81645 (Chrm2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    81645 (Chrm2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    81645 (Chrm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 81645
NCBI-ProteinID: NP_112278
RGD: 620023
Ensembl: ENSRNOG00000046972
UniProt: P10980
Position
4q22
AA seq 466 aa AA seqDB search
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVSRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTETCVQGEEKESSNDSTSSAAVASNMRDDE
ITQDENTVSTSLDHSRDDNSKQTCIKIVTKAQKGDVYTPTSTTVELVGSSGQSGDEKQNV
VARKIVKMPKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcaacaaactcctcgaacaatggcttggctattaccagtccttacaagaca
tttgaagtggtatttattgtccttgtggctggatccctcagtctggtgaccatcattggg
aacattctggtcatggtttccattaaagtcagccgccaccttcagactgtcaacaattac
ttcttgttcagcctggcctgtgctgacctcatcataggtgttttctccatgaacttgtat
accctctacactgtgattggctactggcctttgggacctgtagtatgtgacctatggcta
gcattggactatgttgtcagcaatgcctccgttatgaatctcctcatcatcagctttgat
agatacttctgtgtcacgaaacctctgacctacccagttaagcggaccacaaaaatggca
ggcatgatgattgcagctgcgtgggtcctttccttcatcctctgggccccagccattctc
ttctggcagttcatcgtaggggtgaggactgtggaggatggggaatgctatattcagttc
ttttccaatgcggccgtcaccttcggcactgccattgcagcgttctatctgcctgtcatc
atcatgactgtgctctattggcatatatcccgggcaagcaagagtagaataaagaaggaa
aagaaggaacctgtggccaaccaagacccagtatctccaagtctggtgcaaggaagaatt
gtaaagccaaacaataacaatatgcctggtggtgatggcggcctggaacacaacaagatc
cagaatggcaaggctccacgggacggcgtgactgaaacctgtgttcaaggggaggagaaa
gagagctccaatgattcgacgtcatcagctgctgtggcctccaatatgagagatgatgag
ataacccaggatgaaaacacagtttccacttcgctggaccactccagagatgacaactct
aagcaaacatgcatcaaaattgtcaccaaggcccaaaaaggtgatgtgtacaccccaacg
agtaccactgtagaactagttgggtcgtcgggtcagagtggggatgaaaagcagaacgtt
gtagcccgcaaaatcgtgaagatgcccaagcagcctgccaaaaagaagcctccaccatcc
cgggaaaagaaagtgaccaggacaatcttggctatcctgttggctttcatcataacgtgg
gcgccatacaatgtcatggtgctcatcaatactttctgtgcaccctgcatccccaataca
gtatggacaattggctactggctctgttacatcaatagcaccatcaatccggcctgctat
gcgctttgtaatgccaccttcaaaaagacttttaagcacctcctcatgtgtcattacaag
aacataggcgctacacggtga

DBGET integrated database retrieval system