KEGG   Rattus norvegicus (rat): 81645Help
Entry
81645             CDS       T01003                                 

Gene name
Chrm2, Acm2
Definition
(RefSeq) cholinergic receptor, muscarinic 2
  KO
K04130  muscarinic acetylcholine receptor M2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04151  PI3K-Akt signaling pathway
rno04725  Cholinergic synapse
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    81645 (Chrm2)
   04024 cAMP signaling pathway
    81645 (Chrm2)
   04151 PI3K-Akt signaling pathway
    81645 (Chrm2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81645 (Chrm2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81645 (Chrm2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    81645 (Chrm2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    81645 (Chrm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 81645
NCBI-ProteinID: NP_112278
RGD: 620023
Ensembl: ENSRNOG00000046972
UniProt: P10980
Position
4q22
AA seq 466 aa AA seqDB search
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVSRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGVTETCVQGEEKESSNDSTSSAAVASNMRDDE
ITQDENTVSTSLDHSRDDNSKQTCIKIVTKAQKGDVYTPTSTTVELVGSSGQSGDEKQNV
VARKIVKMPKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaataactcaacaaactcctcgaacaatggcttggctattaccagtccttacaagaca
tttgaagtggtatttattgtccttgtggctggatccctcagtctggtgaccatcattggg
aacattctggtcatggtttccattaaagtcagccgccaccttcagactgtcaacaattac
ttcttgttcagcctggcctgtgctgacctcatcataggtgttttctccatgaacttgtat
accctctacactgtgattggctactggcctttgggacctgtagtatgtgacctatggcta
gcattggactatgttgtcagcaatgcctccgttatgaatctcctcatcatcagctttgat
agatacttctgtgtcacgaaacctctgacctacccagttaagcggaccacaaaaatggca
ggcatgatgattgcagctgcgtgggtcctttccttcatcctctgggccccagccattctc
ttctggcagttcatcgtaggggtgaggactgtggaggatggggaatgctatattcagttc
ttttccaatgcggccgtcaccttcggcactgccattgcagcgttctatctgcctgtcatc
atcatgactgtgctctattggcatatatcccgggcaagcaagagtagaataaagaaggaa
aagaaggaacctgtggccaaccaagacccagtatctccaagtctggtgcaaggaagaatt
gtaaagccaaacaataacaatatgcctggtggtgatggcggcctggaacacaacaagatc
cagaatggcaaggctccacgggacggcgtgactgaaacctgtgttcaaggggaggagaaa
gagagctccaatgattcgacgtcatcagctgctgtggcctccaatatgagagatgatgag
ataacccaggatgaaaacacagtttccacttcgctggaccactccagagatgacaactct
aagcaaacatgcatcaaaattgtcaccaaggcccaaaaaggtgatgtgtacaccccaacg
agtaccactgtagaactagttgggtcgtcgggtcagagtggggatgaaaagcagaacgtt
gtagcccgcaaaatcgtgaagatgcccaagcagcctgccaaaaagaagcctccaccatcc
cgggaaaagaaagtgaccaggacaatcttggctatcctgttggctttcatcataacgtgg
gcgccatacaatgtcatggtgctcatcaatactttctgtgcaccctgcatccccaataca
gtatggacaattggctactggctctgttacatcaatagcaccatcaatccggcctgctat
gcgctttgtaatgccaccttcaaaaagacttttaagcacctcctcatgtgtcattacaag
aacataggcgctacacggtga

DBGET integrated database retrieval system