KEGG   Rattus norvegicus (rat): 81646
Entry
81646             CDS       T01003                                 

Gene name
Creb1
Definition
(RefSeq) cyclic AMP-responsive element-binding protein 1 isoform A
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04380  Osteoclast differentiation
rno04612  Antigen processing and presentation
rno04668  TNF signaling pathway
rno04710  Circadian rhythm
rno04713  Circadian entrainment
rno04714  Thermogenesis
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04931  Insulin resistance
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04962  Vasopressin-regulated water reabsorption
rno05016  Huntington disease
rno05020  Prion disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05203  Viral carcinogenesis
rno05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    81646 (Creb1)
   04024 cAMP signaling pathway
    81646 (Creb1)
   04022 cGMP-PKG signaling pathway
    81646 (Creb1)
   04151 PI3K-Akt signaling pathway
    81646 (Creb1)
   04152 AMPK signaling pathway
    81646 (Creb1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    81646 (Creb1)
  09152 Endocrine system
   04911 Insulin secretion
    81646 (Creb1)
   04922 Glucagon signaling pathway
    81646 (Creb1)
   04915 Estrogen signaling pathway
    81646 (Creb1)
   04926 Relaxin signaling pathway
    81646 (Creb1)
   04935 Growth hormone synthesis, secretion and action
    81646 (Creb1)
   04918 Thyroid hormone synthesis
    81646 (Creb1)
   04928 Parathyroid hormone synthesis, secretion and action
    81646 (Creb1)
   04916 Melanogenesis
    81646 (Creb1)
   04924 Renin secretion
    81646 (Creb1)
   04925 Aldosterone synthesis and secretion
    81646 (Creb1)
   04927 Cortisol synthesis and secretion
    81646 (Creb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81646 (Creb1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    81646 (Creb1)
  09156 Nervous system
   04725 Cholinergic synapse
    81646 (Creb1)
   04728 Dopaminergic synapse
    81646 (Creb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    81646 (Creb1)
  09149 Aging
   04211 Longevity regulating pathway
    81646 (Creb1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    81646 (Creb1)
   04713 Circadian entrainment
    81646 (Creb1)
   04714 Thermogenesis
    81646 (Creb1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81646 (Creb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    81646 (Creb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    81646 (Creb1)
   05161 Hepatitis B
    81646 (Creb1)
   05163 Human cytomegalovirus infection
    81646 (Creb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    81646 (Creb1)
   05165 Human papillomavirus infection
    81646 (Creb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    81646 (Creb1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    81646 (Creb1)
   05020 Prion disease
    81646 (Creb1)
  09165 Substance dependence
   05030 Cocaine addiction
    81646 (Creb1)
   05031 Amphetamine addiction
    81646 (Creb1)
   05034 Alcoholism
    81646 (Creb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    81646 (Creb1)
   04934 Cushing syndrome
    81646 (Creb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81646 (Creb1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    81646 (Creb1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    81646 (Creb1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    81646 (Creb1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf HNF-1A_C
Other DBs
NCBI-GeneID: 81646
NCBI-ProteinID: NP_604392
RGD: 620218
Ensembl: ENSRNOG00000013412
UniProt: P15337
Structure
PDB: 
1KDX

Position
9
AA seq 327 aa
MTMDSGADNQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggactctggagcagacaaccagcagagtggagatgctgctgtaacagaagct
gaaagtcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcatgcgacgtcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggggtcatccaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcacaggagtct
gtggatagtgtaactgattcccaaaaacgaagggaaatcctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggggtgccaaggattgaagaagaa
aaatcagaagaagagacttcagcccctgccatcaccactgtaacagtgccaaccccgatt
taccaaactagcagtgggcagtatattgccattacccagggaggagcaatacagctggct
aacaatggtaccgatggggtacagggcctgcagacattaaccatgaccaatgcagctgcc
actcagccgggtactaccattctacaatatgcacagaccactgatggacagcagattcta
gtgcccagcaaccaagttgttgttcaagctgcctctggtgatgtacaaacataccagatt
cgcacagcacccactagcaccattgcccctggagttgttatggcgtcctccccagcactt
cctacacagcctgctgaagaagcagcacgaaagagagaggttcgtctaatgaagaacagg
gaagcagcaagagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagagaacaga
gtggcagtgcttgaaaaccaaaacaaaacattgattgaggagctaaaagcacttaaggac
ctttactgccacaagtcagattaa

DBGET integrated database retrieval system