KEGG   Rattus norvegicus (rat): 81647Help
Entry
81647             CDS       T01003                                 

Gene name
Atf2
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04714  Thermogenesis
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    81647 (Atf2)
   04668 TNF signaling pathway
    81647 (Atf2)
   04022 cGMP-PKG signaling pathway
    81647 (Atf2)
   04151 PI3K-Akt signaling pathway
    81647 (Atf2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    81647 (Atf2)
   04922 Glucagon signaling pathway
    81647 (Atf2)
   04915 Estrogen signaling pathway
    81647 (Atf2)
   04926 Relaxin signaling pathway
    81647 (Atf2)
   04918 Thyroid hormone synthesis
    81647 (Atf2)
   04928 Parathyroid hormone synthesis, secretion and action
    81647 (Atf2)
   04925 Aldosterone synthesis and secretion
    81647 (Atf2)
   04927 Cortisol synthesis and secretion
    81647 (Atf2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81647 (Atf2)
  09156 Nervous system
   04728 Dopaminergic synapse
    81647 (Atf2)
  09149 Aging
   04211 Longevity regulating pathway
    81647 (Atf2)
  09159 Environmental adaptation
   04714 Thermogenesis
    81647 (Atf2)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    81647 (Atf2)
  09165 Substance dependence
   05030 Cocaine addiction
    81647 (Atf2)
   05031 Amphetamine addiction
    81647 (Atf2)
   05034 Alcoholism
    81647 (Atf2)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    81647 (Atf2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    81647 (Atf2)
   05164 Influenza A
    81647 (Atf2)
   05161 Hepatitis B
    81647 (Atf2)
   05163 Human cytomegalovirus infection
    81647 (Atf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81647 (Atf2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    81647 (Atf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2
Motif
Other DBs
NCBI-GeneID: 81647
NCBI-ProteinID: NP_112280
RGD: 621862
Ensembl: ENSRNOG00000001597
UniProt: Q00969
Position
3q23
AA seq 487 aa AA seqDB search
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPL
PHPESTTNDEKEIPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVI
TQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSV
PGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRAQSEESRPQSLQQP
ATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQ
SLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSS
EDLSVPSSPHTEAIQHSSVSTSNGVSSTSKTEAGATSVLTQMADQSTEPALSQIVMAPSS
QAQPSGS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgacaaaccctttctatgcactgcccctgggtgtggccagcgttttaccaac
gaggatcatttggctgtccataaacataaacatgagatgacactgaaatttggtccagca
cgtaatgacagtgtcattgtggctgatcagactccaacaccaacaaggttcctaaaaaac
tgtgaagaagtgggtttgtttaatgagttggcaagtccattcgagaatgaattcaagaag
gcttcagaagatgacattaaaaaaatgcctctagatctgtcccctcttgcaacacccatc
ataagaagcaaaattgaggaaccttctgttgtagaaacaactcaccaggatagcccgtta
cctcaccccgagtctactaccaatgatgaaaaggaaataccattggcacaaactgcacag
cccacatcagctatcgttcgtccagcatcattacaggttcccaatgtgctgctcacaagt
tctgactcaagtgtaattattcaacaagcagtaccttcaccaacctcaagtactgtaatc
acccaggcaccatcctctaacaggccaattgttcctgtaccaggcccatttcctcttcta
ttacatcttcctaatggacaaaccatgcccgttgctattcctgcatcaattacaagttct
aatgtgcatgttccagctgcagtcccacttgttcggccagtcaccatggtgcctagtgtt
ccaggaatcccaggcccttcctctcctcaaccggtccagtcagaagcaaaaatgagatta
aaagctgctttgacccagcaacaccctccagttaccaatggtgatactgtaaaaggccac
ggcagtggattggttagggcccagtcagaagagtctcgtccacagtccttgcagcagcca
gccacgtccactacagagactccggcgtctccagctcacacaactccacagacccaaaat
acaagtggccgtcgaagaagagcagctaatgaagatcctgatgagaaaaggaggaagttt
ctagaacgaaatagagcagcagcttcaagatgccgtcaaaaaaggaaagtatgggttcag
tccttagagaagaaagcagaagacttgagctcactaaatggccagctgcagagcgaagtc
accctgctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgc
cctgtaaccgccatgcagaagaagtctggctatcatactgctgataaagatgacagctca
gaagacctttccgtgccaagcagcccacatacagaagcgatccagcacagctctgtcagt
acgtccaatggagtcagttcaacatcaaaaacagaagctggagccacttcagttctcacc
cagatggcggaccagagcaccgagcctgcactttcacagattgtcatggctccttcctcc
caggcacagccctcaggaagttga

DBGET integrated database retrieval system