KEGG   Rattus norvegicus (rat): 81655Help
Entry
81655             CDS       T01003                                 

Gene name
Dync1li2, Dncli2, Lic2
Definition
(RefSeq) dynein, cytoplasmic 1 light intermediate chain 2
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04962  Vasopressin-regulated water reabsorption
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    81655 (Dync1li2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    81655 (Dync1li2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81655 (Dync1li2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81655 (Dync1li2)
   03036 Chromosome and associated proteins [BR:rno03036]
    81655 (Dync1li2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81655 (Dync1li2)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    81655 (Dync1li2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      81655 (Dync1li2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     81655 (Dync1li2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DLIC ABC_tran AAA_22 AAA_16 Arf Roc PduV-EutP AAA_7 AAA_24 AAA_29 NACHT ATPase G-alpha AAA_25 SRP54
Motif
Other DBs
NCBI-GeneID: 81655
NCBI-ProteinID: NP_112288
RGD: 621130
Ensembl: ENSRNOG00000025791
Vega: OTTRNOG00000001229
UniProt: Q62698
Position
19p14
AA seq 497 aa AA seqDB search
MAPVGVEKKLLLGPNGPAVAAAGDLTSEEEEGQSLWSSILSEVSTRARSKLPSGKNILVF
GEDGSGKTTLMTKLQGAEHGKKGRGLEYLYLSVHDEDRDDHTRCNVWILDGDLYHKGLLK
FAVSAESLRETLVIFVADMSRPWTIMESLQKWASVLREHIDKMKIPPEEMRDLERKFMKD
FQDYIEPEEGCQGSPQRRGPLTSGSDEDNVALPLGDNVLTHNLGIPVLVVCTKCDAVSIL
EKEHDYRDEHLDFIQAHLRGFCLQYGAALIYTSVKEEKNLDLLYKYIVHKTYGFHFTIPA
LVVEKDAVFIPAGWDNEKKIAILHENFTTVKPEDAYEDFIVKPPVRKLVHDKELAAEDEQ
VFLMKQQESPARGPSGSPRTQGRGGPASVPSASPGTSVKKPDPNIKNNAASEGVLASFFN
SLLSKKTGSPGSPSAGGVQSTAKKSGTEGEPQSFRSLTEQCCQTGQKTVLSNVQEELDRM
TRKPDSMVTNSSTENEA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcgccggtgggggtggagaagaagctgctgctgggtcccaacgggcccgcagtggcg
gctgccggcgacctgaccagtgaagaggaggaaggccagagtctatggtcttcgatcttg
agcgaagtgtccacccgcgccaggtccaagctgccgtccggcaagaacattctggtgttc
ggtgaagatggttctggtaaaacaactctcatgaccaaactccaaggagcagagcacggc
aaaaaaggaagaggcttagagtatctttacctcagcgttcatgatgaggaccgtgatgat
cacacgcgctgcaatgtatggattttggatggagacctttaccacaaaggcctgctgaaa
tttgcagtttccgcggagtctttgcgggagaccctggtcatttttgttgcagacatgtct
agaccttggactataatggaatctctacagaaatgggctagtgttttacgggagcacatt
gacaagatgaaaattccaccagaggaaatgagggatctggaacggaagtttatgaaagat
tttcaagattatatcgagcctgaagaaggttgtcagggttccccacagagaagagggcct
ctgacctcaggctcagatgaagacaatgttgccctccctctgggtgacaatgtgctgact
cataacctggggatcccagtgttggttgtgtgcacaaagtgtgatgcagtgagcatcttg
gagaaggagcacgattaccgagacgagcacctggacttcatccaggcgcatctgcgggga
ttctgcctccagtatggagctgccttgatttacacctcagtgaaggaagagaaaaacctt
gacttgctgtataagtacattgttcataaaacatacggcttccacttcaccatacccgcc
ttagttgtggaaaaggacgcagtttttatacctgcaggatgggacaatgaaaagaaaata
gctattttacatgaaaattttacaaccgtgaagccagaagatgcatatgaagattttatt
gtaaagcctcctgtgagaaagctggtccatgacaaagagttggcagctgaggatgagcag
gtgttcctgatgaaacaacaggaatcccctgccagaggaccctctggctctccaaggacg
cagggtcggggtggaccagctagtgtaccaagcgcctccccaggaacatcagtaaagaag
ccagatccaaacatcaaaaataatgcagcaagtgaaggggtattggccagcttcttcaat
agtctgttgagtaaaaagacaggctctcctggaagtcccagtgctggtggagtgcagagc
acagccaagaagtcaggtacagaaggagagccccagagcttcagatccttaacagaacag
tgctgtcaaacaggacaaaagactgtgttgtcaaacgttcaggaagaactggatagaatg
actcgaaaaccagactccatggtaacgaactcttcaacagaaaacgaagcctga

DBGET integrated database retrieval system