KEGG   Rattus norvegicus (rat): 81657
Entry
81657             CDS       T01003                                 

Gene name
Gabbr1
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 1 precursor
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04727  GABAergic synapse
rno04742  Taste transduction
rno04915  Estrogen signaling pathway
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    81657 (Gabbr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81657 (Gabbr1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    81657 (Gabbr1)
   04915 Estrogen signaling pathway
    81657 (Gabbr1)
  09156 Nervous system
   04727 GABAergic synapse
    81657 (Gabbr1)
  09157 Sensory system
   04742 Taste transduction
    81657 (Gabbr1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    81657 (Gabbr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    81657 (Gabbr1)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  GABA
   81657 (Gabbr1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 Peripla_BP_6 Sushi UPF0242 DUF3995 NEMP COX1
Other DBs
NCBI-GeneID: 81657
NCBI-ProteinID: NP_112290
RGD: 621537
Ensembl: ENSRNOG00000000774
Vega: OTTRNOG00000001460
UniProt: Q9Z0U4 Q6MFX8
Structure
PDB: 
1SRZ 1SS2

Position
20
AA seq 960 aa
MLLLLLVPLFLRPLGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDY
EIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPA
LDGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGG
WPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKII
LMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLF
EKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARI
IVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEG
HITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALAL
NKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQ
LQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSL
GIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRSQFPF
VCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMD
VLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLL
LLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAI
VFSSYITLVVLFVPKMRRLITRGEWQSETQDTMKTGSSTNNNEEEKSRLLEKENRELEKI
IAEKEERVSELRHQLQSRQQLRSRRHPPTPPDPSGGLPRGPSEPPDRLSCDGSRVHLLYK
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgctgctgctgctgctggtgcctctcttcctccgccccctgggcgctggcggggcgcag
acccccaacgccacctcggaaggttgccagattatacatccgccctgggaaggtggcatc
aggtaccgtggcttgactcgcgaccaggtgaaggccatcaacttcctgcctgtggactat
gagatcgaatatgtgtgccgaggggagcgcgaggtggtggggcccaaggtgcgcaaatgc
ctggccaacggctcctggacggatatggacacacccagccgctgtgtccgaatctgctcc
aagtcttatttgaccctggaaaatgggaaggttttcctgacgggtggggacctcccagct
ctggatggagcccgggtggagttccgatgtgaccccgacttccatctggtgggcagctcc
cggagcgtctgtagtcagggccagtggagcacccccaagccccactgccaggtgaatcga
acgccacactcagaacggcgtgcagtatacatcggggcgctgtttcccatgagcgggggc
tggccggggggccaggcctgccagcccgcggtggagatggcgctggaggacgttaacagc
cgcagagacatcctgccggactacgagctcaagcttatccaccacgacagcaagtgtgac
ccagggcaagccaccaagtacttgtacgaactactctacaatgaccccatcaagatcatt
ctcatgcctggctgtagttctgtctccacacttgtagctgaggctgcccggatgtggaac
cttattgtgctctcatatggctccagttcaccagccttgtcaaaccgacagcggtttccc
acgttcttccggacgcatccatccgccacactccacaatcccacccgggtgaaactcttc
gaaaagtggggctggaagaagatcgctaccatccaacagaccaccgaggtcttcacctca
acgctggatgacctggaggagcgagtgaaagaggctgggatcgagatcactttccgacag
agtttcttctcggatccagctgtgcctgttaaaaacctgaagcgtcaagatgctcgaatc
atcgtgggacttttctatgagacggaagcccggaaagttttttgtgaggtctataaggaa
aggctctttgggaagaagtacgtctggttcctcatcgggtggtatgctgacaactggttc
aagacctatgacccgtcaatcaattgtacagtggaagaaatgaccgaggcggtggagggc
cacatcaccacggagattgtcatgctgaaccctgccaacacccgaagcatttccaacatg
acgtcacaggaatttgtggagaaactaaccaagcggctgaaaagacaccccgaggagact
ggaggcttccaggaggcaccactggcctatgatgctatctgggccttggctttggccttg
aacaagacgtctggaggaggtggtcgttccggcgtgcgcctggaggactttaactacaac
aaccagaccattacagaccagatctaccgggccatgaactcctcctcctttgagggcgtt
tctggccatgtggtctttgatgccagcggctcccggatggcatggacacttatcgagcag
ctacagggcggcagctacaagaagatcggctactacgacagcaccaaggatgatctttcc
tggtccaaaacggacaagtggattggagggtctcccccagctgaccagaccttggtcatc
aagacattccgtttcctgtctcagaaactctttatctccgtctcagttctctccagcctg
ggcattgttcttgctgttgtctgtctgtcctttaacatctacaactcccacgttcgttat
atccagaactcccagcccaacctgaacaatctgactgctgtgggctgctcactggcactg
gctgctgtcttccctctcgggctggatggttaccacatagggagaagccagttcccgttt
gtctgccaggcccgcctttggctcttgggcttgggctttagtctgggctatggctctatg
ttcaccaagatctggtgggtccacacagtcttcacgaagaaggaggagaagaaggagtgg
aggaagaccctagagccctggaaactctatgccactgtgggcctgctggtgggcatggat
gtcctgactcttgccatctggcagattgtggaccccttgcaccgaaccattgagactttt
gccaaggaggaaccaaaggaagacatcgatgtctccattctgccccagttggagcactgc
agctccaagaagatgaatacgtggcttggcattttctatggttacaaggggctgctgctg
ctgctgggaatctttcttgcttacgaaaccaagagcgtgtccactgaaaagatcaatgac
cacagggccgtgggcatggctatctacaatgtcgcggtcctgtgtctcatcactgctcct
gtgaccatgatcctttccagtcagcaggacgcagcctttgcctttgcctctctggccatc
gtgttctcttcctacatcactctggttgtgctctttgtgcccaagatgcgcaggctgatc
acccgaggggaatggcagtctgaaacgcaggacaccatgaaaacaggatcatccaccaac
aacaacgaggaagagaagtcccgactgttggagaaggaaaaccgagaactggaaaagatc
atcgctgagaaagaggagcgcgtctctgaactgcgccatcagctccagtctcggcagcaa
ctccgctcacggcgccaccccccaacacccccagatccctctgggggccttcccagggga
ccctctgagccccctgaccggcttagctgtgatgggagtcgagtacatttgctttacaag
tga

KEGG   Rattus norvegicus (rat): 83633
Entry
83633             CDS       T01003                                 

Gene name
Gabbr2
Definition
(RefSeq) gamma-aminobutyric acid type B receptor subunit 2 precursor
  KO
K04615  gamma-aminobutyric acid type B receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04727  GABAergic synapse
rno04742  Taste transduction
rno04915  Estrogen signaling pathway
rno04929  GnRH secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    83633 (Gabbr2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    83633 (Gabbr2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    83633 (Gabbr2)
   04915 Estrogen signaling pathway
    83633 (Gabbr2)
  09156 Nervous system
   04727 GABAergic synapse
    83633 (Gabbr2)
  09157 Sensory system
   04742 Taste transduction
    83633 (Gabbr2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    83633 (Gabbr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    83633 (Gabbr2)
G protein-coupled receptors [BR:rno04030]
 Metabotropic glutamate receptor family
  GABA
   83633 (Gabbr2)
SSDB
Motif
Pfam: 7tm_3 ANF_receptor GBR2_CC Peripla_BP_6 Cation_ATPase_C GAPT APG6_N HOOK DUF812
Other DBs
NCBI-GeneID: 83633
NCBI-ProteinID: NP_113990
RGD: 619864
Ensembl: ENSRNOG00000008431
UniProt: O88871
Position
5
AA seq 940 aa
MASPPSSGQPRPPPPPPPPARLLLPLLLSLLLWLAPGAWGWTRGAPRPPPSSPPLSIMGL
MPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAI
KYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNA
VNPAILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVK
KLKGNDVRIILGQFDQNMAAKVFCCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSR
CLRRSLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNSKRSGVGPSKFHGYAYDG
IWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGKIILNAMNETNFFGVTGQVVFRNGE
RMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPL
YSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDG
SFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIV
GGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVY
AYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQF
CIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVN
QASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILSLG
NFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHH
AYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggcttccccgccgagctccgggcagccccggccgccgccgccgccgccgccgcccgcg
cgcctgctgctgcccctgctgctgtcgctgctgctgtggttggcgcccggggcctggggc
tggacgcggggcgccccccggccgccgcccagcagcccgccgctctccatcatgggcctc
atgccgctcaccaaggaggtggccaagggcagcatcgggcgcggcgtgctccccgccgtg
gagctagccatcgagcagatccgcaacgagtcactcctgcgcccctacttcctggacctg
cgactctatgacaccgagtgtgacaatgcaaagggactgaaagccttctatgacgcaata
aagtatgggccgaaccatttgatggtgtttggaggcgtctgtccgtctgtcacatctatt
atcgcggagtccctccaaggctggaatctggtgcagctttccttcgccgccaccacgcct
gttcttgcggataagaagaagtacccgtatttcttccggacggtgccgtcagacaacgcg
gtgaaccccgccatcctgaagctcctgaagcacttccgttggcggcgtgtgggcacactc
acgcaggacgtgcagcgcttctccgaggtgaggaatgacctgactggggttctgtatggg
gaagatattgagatctcagacacagagagcttctccaatgatccctgcaccagcgtcaaa
aagctcaaggggaatgacgtgcggatcatccttggccagtttgaccagaatatggcagca
aaagtcttctgttgtgccttcgaggagagcatgtttggcagcaagtaccagtggatcatc
ccgggatggtacgagcctgcgtggtgggagcaggtgcatgtggaggccaattcctcacgc
tgcctgcgcagaagcctcctggctgccatggaaggttacatcggagtggactttgagccc
ctgagctccaaacaaatcaagaccatctcagggaagactccacagcagtatgaaagagag
tacaacagcaaacgttcaggcgtggggcccagcaagttccatgggtacgcctacgatggg
atctgggtcatcgccaagaccctacagagggccatggagacactgcatgccagtagcagg
caccagcggatccaggacttcaactacacagaccacacgctgggcaaaatcatcctcaat
gccatgaacgagaccaacttcttcggggtcacgggtcaagttgtgttccggaacggggag
agaatgggaaccattaaatttactcaatttcaagacagcagagaggtgaaggtcggcgaa
tacaacgcggtggctgacacactggagatcatcaatgacaccataaggttccaggggtcc
gagccacccaaggacaagaccatcattctggagcagcttcggaagatctcgcttccactg
tatagcatcctgtccgctctcaccatcctcggcatgatcatggccagcgccttcctcttc
ttcaacatcaagaaccggaaccaaaagctgattaagatgtcaagcccctacatgaacaac
ctcatcatcctgggaggaatgctgtcctatgcatccatcttcctctttggcctcgatggg
tccttcgtctcagaaaagacctttgaaacactctgcacggtccggacctggattctcacc
gtgggctacacaactgcctttggggccatgtttgcaaagacctggagggtccatgccatc
ttcaaaaatgtgaagatgaagaagaagatcatcaaagaccagaagctgcttgtgattgtg
gggggcatgctgctcatcgacctgtgcatcctgatctgttggcaggctgtggaccccctg
cggaggacagtggagaggtacagcatggagccggacccagcaggccgggacatctccatc
cgcccattgctggaacactgcgaaaacacccacatgaccatctggcttggcattgtctac
gcctacaaggggctcctcatgctattcggttgtttcttggcatgggaaacccgcaatgtg
agcatccctgccctcaacgacagcaagtacatcggcatgagtgtgtacaatgtggggatc
atgtgcatcatcggggctgctgtctccttcctgacgcgtgaccagcccaacgtgcagttc
tgcatcgtggccctggtcatcatcttctgcagcaccatcactctctgcctggtgtttgtg
ccaaagctcatcactctgaggacaaaccctgacgcagccactcagaacaggcggttccag
ttcacacagaaccagaagaaagaagattcgaagacctccacttcagtcaccagcgtgaac
caggcgagcacgtcacgcctggagggactgcagtcagaaaaccaccgccttcgaatgaag
atcacagagctggacaaagacttggaagaagtcaccatgcagctacaagacacaccagag
aagaccacatacatcaaacagaatcactaccaagagctcaacgacatcctcagcttgggc
aacttcacagagagcacagatggaggaaaggccattctaaaaaatcacctcgatcaaaac
ccccagctccagtggaacacgacagagccctcaagaacatgcaaagaccccatagaagac
atcaactccccggagcacatccagcgccggctgtcgctccagctccccatccttcaccac
gcctacctcccatccatcggaggcgtggatgccagctgcgtcagcccctgtgtcagccct
accgccagccctcgccacagacacgtaccaccctccttccgagtcatggtctcgggcctg
tag

DBGET integrated database retrieval system