KEGG   Rattus norvegicus (rat): 81658
Entry
81658             CDS       T01003                                 

Gene name
Gabrp
Definition
(RefSeq) gamma-aminobutyric acid type A receptor pi subunit
  KO
K05189  gamma-aminobutyric acid receptor subunit pi
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04723  Retrograde endocannabinoid signaling
rno04727  GABAergic synapse
rno05032  Morphine addiction
rno05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81658 (Gabrp)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    81658 (Gabrp)
   04723 Retrograde endocannabinoid signaling
    81658 (Gabrp)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    81658 (Gabrp)
   05033 Nicotine addiction
    81658 (Gabrp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    81658 (Gabrp)
Ion channels [BR:rno04040]
 Ligand-gated channels
  GABA-A
   81658 (Gabrp)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 81658
NCBI-ProteinID: NP_112291
RGD: 620532
Ensembl: ENSRNOG00000032417
UniProt: O09028
Position
10q12
AA seq 440 aa
MSYSLYLAFVCLNLLAQRMCIQGNQFNVEVSRSDKLSLPGFENLTAGYNKFLRPNFGGDP
VRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKSFTLDARLVEFLWVPDT
YIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMDLSKYPMDTQTCKLQLES
WGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVSQQETGNYTRLVLQFELRR
NVLYFILETYVPSTFLVVLSWVSFWISLESVPARTCIGVTTVLSMTTLMIGSRTSLPNTN
CFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDRGPAKDSEEVNITNIINSSIS
SFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKIGRIIDYFTIQNPSNVDRYSKL
LFPLIFMLANVFYWAYYMYF
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgagctacagtctctatttggcctttgtgtgtctgaatctcctcgctcaaaggatgtgc
atccaggggaaccagttcaatgtggaggtcagcagaagcgacaagctttccttgcctgga
tttgagaacctcactgcaggatataacaaattcctcaggcccaattttggtggtgaccca
gttcggatagcgctgactctggacatcgcaagcatctctagtatttcagagagtaacatg
gactacacagccactatatacctccgacagcgctggaccgacccacggctggtgttcgaa
ggcaacaagagctttactctagatgcccgtctcgtggagttcctctgggtgccagatact
tacatcgtggagtccaagaagtccttcctgcatgaagtcacggtgggaaacaggctcatc
cgcctcttctccaacggcacagtcttgtatgcactcagaatcacaacaacagttacatgt
aacatggatctgtcgaaataccccatggacacacagacctgcaagttgcagctggaaagt
tggggatacgatggcaatgacgtggagttctcctggctaagagggaacgattcggtacgt
ggactcgaaaacctgcgccttgctcagtacaccatccaacagtatttcaccctggtcacc
gtatcccagcaggagacaggaaactatacgcggttggttttgcaatttgagcttcggagg
aatgtcctgtatttcattctggaaacctacgtcccttccaccttcctggtggtgttatcc
tgggtctccttttggatctctctcgagtcggttcctgcgagaacctgcattggagtgaca
acagtgttgtccatgacaacgctgatgattggctcccgcacatccctacccaacaccaac
tgcttcataaaggccattgatgtttacctggggatttgcttcagctttgtgtttggggcc
ttactggagtatgcagttgctcactacagctccttacagcagatggcagtcaaagatagg
gggccagcaaaggactcagaagaagtcaatatcaccaacatcatcaacagctccatctcc
agctttaaacgaaagatcagcttcgccagcattgaaatttctggcgacaatgtcaactac
agcgacctgacgatgaaagccagcgacaagtttaagtttgtcttccgagaaaagatcggc
agaatcattgattacttcacaattcaaaatcccagcaacgtggatcgatattccaaacta
ctgtttcctttgatttttatgttggccaatgtattttactgggcatactacatgtatttt
tga

DBGET integrated database retrieval system