KEGG   Rattus norvegicus (rat): 81659
Entry
81659             CDS       T01003                                 

Gene name
Gak
Definition
(RefSeq) cyclin G associated kinase
  KO
K08855  cyclin G-associated kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81659 (Gak)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81659 (Gak)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     81659 (Gak)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   81659 (Gak)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    81659 (Gak)
SSDB
Motif
Pfam: Pkinase PTEN_C2 PK_Tyr_Ser-Thr DnaJ Kinase-like Seadorna_VP7 DSPc
Other DBs
NCBI-GeneID: 81659
NCBI-ProteinID: NP_112292
RGD: 621589
Ensembl: ENSRNOG00000000048
UniProt: P97874
Position
14p22
AA seq 1305 aa
MSLLQSALDFLAGPGSLGGAAGRDQSDFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDL
GSGREYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPNIVQFCSAASIGKEESDTGQAEFL
LLTELCKGQLVEFLRRVECKGPLSCDSILKIFYQTCRAVQHMHRQKPPIIHRDLKVENLL
LSNQGTIKLCDFGSATTISHYPDYSWSAQKRAMVEEEITRNTTPMYRTPEIVDLYSNFPI
GEKQDIWALGCILYLLCFRQHPFEDGAKLRIVNGKYSIPVNDTRYTVFHDLIRGMLKVNP
EERLSIAEVVRQLQEIAAARNVNPKAPITELLEQNGGYGNSGPSRAQPPSGGPVNSSGVL
ALAEYDQPYGGFLDILRGGTERLFTNLKDTSSKVIQSVANYAKGDLDISYITSRIAVMSF
PAEGVESAIKNNIEDVRLFLDAKHPGHYAVYNLSPRIYRASKFHNRVTECGWAVRRAPHL
HSLYTLCRSMHAWLREDHRNVCVVHCMDGRAASAVAVCAFLCFCRLFSTAEAAVYMFSMK
RCPPGIWPSHKRYIEYVCDMVAEEPITPHSKPMLVKSVVMTPVPLFSKQRNGCRPFCEVY
VGEERVTTTSQEYDRMKEFKIEDGKAVIPLGITVQGDVLTIIYHARSTLGGRLQAKMASM
KMFQIQFHTGFVPRNATTVKFAKYDLDACDIQEKYPDLFQVNLEVEVEPRDRPSRDVPPW
ENTSLRGLNPKILFSNREEQQDILSKFGKPELPRQPGSTAQYDAEAGSPEAEITESDSPQ
SSSTDTNHFLHTLDWQEEKDPETGVDNTSPKESQSNLIADGDGSEVSDEEEASCPSEERK
PGAGEDTPRLAAGTRQQDLIFDVGMLAAPQEPVQPEEGVDLLGLHSEGDLRPAAPLQASG
VQSSNTDLLSSLLEPSDASQVGPPGDLLGGETPLLLASPVSLLGVQSNLQGKVPDTVDPF
DQFLLPSSSDTQPCSKPDLFGEFLNSDSVASSTAFPSTHSAPPPSCSTAFLHLGDLPAEP
NKVIASSSHPDLLGGWDTWAETALPGPASMPVPEGTLFSSAGHPAPPGPNPSQTKSQNPD
PFADLSDLSSSLQGLPAGLPAGSFVGTSATTHKSNSSWQTTRPTAPGTSWPPQAKPAPRA
SEQLRSHFSVIGAREERGVRAPSFAQKPKVSENDFEDLLPNQGFSKSDKKGPKTMAEMRK
QELARDTDPFKLKLLDWIEGKERNIRALLSTLHTVLWDGESRWTPVSMADLVTPEQVKKQ
YRRAVLVVHPDKATGQPYEQSAKMIFMELNDAWSEFENQGSRPLF
NT seq 3918 nt   +upstreamnt  +downstreamnt
atgtcgctgctgcagtctgcactggacttcctggcgggccctggttctcttggcggagct
gccggccgtgaccagagtgacttcgtggggcagactgtggagctgggcgagctgcgtctg
cgggtgcggcgggtcctggccgagggagggtttgcatttgtttatgaagctcaagatctg
ggaagtggcagagagtatgcattaaagagattactatccaatgaagaggaaaagaacaga
gccatcattcaggaagtatgtttcttgaaaaaactttctggccaccccaatattgtccag
ttctgctctgcagcatccataggaaaagaggaatcggacactgggcaggctgagttcctc
ctgcttacggagctctgtaaaggacagctggtggagtttctcaggagagttgaatgtaaa
ggccctctatcctgcgacagcattctgaagatcttctaccagacatgcagagcagtgcag
cacatgcacaggcagaaaccacccatcatccacagggatctcaaggttgaaaacttactg
cttagtaaccaggggaccattaagctgtgtgactttggcagtgccacaaccatctcccat
tatcctgactacagctggagcgcccagaagcgagcaatggtggaggaagagatcacgagg
aacaccacacccatgtacagaacgccagaaattgtagacctgtattctaacttccctatt
ggcgaaaagcaggatatctgggcactgggctgtatcttatacctgctgtgtttccggcag
catccttttgaagatggagcaaaacttcggatagtcaatgggaagtattccattcctgtg
aatgacactcgttacacagtcttccatgaccttattcgtggcatgctaaaggtcaatcca
gaagagaggctatccattgctgaagttgtccgacaactgcaggaaattgcagcagcccgg
aatgtgaaccccaaagcccccatcacagaacttctggagcagaatggtggctatgggaac
tcagggccttcccgagcacaaccaccttctgggggccctgtgaacagcagtggagttttg
gctctggcagagtatgaccagccctatggtgggtttctcgatatcctacggggtgggaca
gaacggctcttcaccaacctcaaggatacttcctccaaggtcatccagtctgtggctaac
tatgcaaagggcgatcttgacatatcttacatcacatccaggattgcagtgatgtcgttc
ccagcagaaggtgtggagtcagcaatcaaaaacaatatagaggatgtacgattgtttctg
gatgccaagcatccaggacattatgctgtctacaacctttctccaagaatataccgggct
tccaagttccacaatcgggtcactgagtgtggctgggcagtcaggcgggcaccacatctc
cacagtttgtatactctatgcaggagcatgcatgcctggctccgggaagaccacaggaac
gtctgtgttgtacattgcatggatgggagagctgcgtctgctgtggcagtctgtgcattc
ctgtgcttctgccgtctcttcagcactgcagaggctgctgtgtacatgttcagcatgaag
cgctgcccaccaggcatttggccatcccacaaaaggtacattgaatacgtgtgtgacatg
gtggcagaggaacccatcacgccccacagcaagccaatgctggtgaaatctgttgtcatg
acccctgtgccactgttcagcaagcagaggaatggctgccgaccattctgtgaggtctat
gttggggaggagcgtgtaaccaccacatcccaggagtatgacaggatgaaggaatttaaa
attgaggatggcaaggctgtcatccccctgggcataacagttcaaggcgatgtcctcacc
atcatttaccatgccagatccactttaggagggagactgcaggccaagatggcgtccatg
aaaatgttccagattcagttccacactgggttcgtgcctcgaaacgcaaccactgtgaaa
tttgcaaagtatgacctggatgcttgtgacattcaagagaagtacccagatctgttccag
gtgaacctggaagtggaggtggagcctagagacaggcccagccgagacgttccaccttgg
gagaataccagcctaagggggttaaaccccaagatcctcttttccaacagggaagagcaa
caggacattctgtctaagtttgggaaaccagagctaccccggcagccgggctccacagct
cagtatgatgctgaggcagggtctccagaggctgagatcacagagtcggactcaccacag
agcagcagcacggacaccaaccactttcttcacacactggattggcaggaggaaaaagac
ccagagactggtgtagacaatacctctcctaaggagagtcagtctaacctgattgcagat
ggagatggaagtgaagtatcagatgaagaagaggcttcatgccctagtgaagagagaaag
cctggggctggagaagatacaccaaggctggcagctgggaccagacagcaagacttaata
tttgatgtgggcatgctggctgccccacaggagcctgtacagcctgaagaaggtgtcgat
ctcctggggctgcactctgaaggggacttaaggcctgctgctcccttgcaggctagcggg
gtccagtctagcaacactgacctgttgagctcccttcttgaaccatctgatgcttctcaa
gtgggacctcctggtgacctgcttggtggtgagactcctctgctgttagcaagcccagtt
tctcttcttggggtgcagagcaacctgcaaggaaaagtccctgacactgtggacccattt
gaccagttcctgctgccatccagctcggacacccagccctgctccaagcctgatctcttt
ggagagtttctcaactctgactctgtagcttcctcaactgccttcccatcgacccacagc
gccccacccccatcctgcagcactgccttcctgcacctgggagatctgccagcagagccc
aacaaggtgattgcttcatccagccacccagatctgctaggaggatgggatacgtgggct
gagactgctctacctgggccggcctccatgccagtaccagaaggtactctcttctcttct
gcaggtcacccagcccctccaggccccaaccccagccaaaccaagtctcagaacccagac
ccatttgctgacctcagtgatctcagctctagcctccaaggcttgcctgctggacttcct
gcagggagcttcgttggcacatcagccaccactcacaaaagcaacagctcctggcagaca
actcgtcccacagcccctggaacctcatggcccccgcaggccaagccagcccccagagcc
tctgaacaactaaggtctcactttagtgtgattggggcccgagaagagagaggtgtccgt
gcgcccagctttgcccaaaagccaaaggtctcagaaaatgattttgaagatctgctgcct
aatcaaggcttctctaagtctgacaagaaggggccaaagaccatggcagagatgcggaaa
caggaacttgccagagatacagacccattcaaattgaagcttttggactggattgaaggc
aaagagaggaatattcgtgcactgctgtccactctgcacacagtattgtgggatggggag
agccgctggacacctgtgagtatggctgacctggtgactccagagcaggtgaagaagcag
taccgccgtgcagtgctggtagtgcatcctgataaggccacagggcagccatatgaacag
tctgccaagatgatcttcatggagctgaatgatgcatggtctgagtttgaaaaccagggc
tcaaggcccctcttctga

DBGET integrated database retrieval system