KEGG   Rattus norvegicus (rat): 81660Help
Entry
81660             CDS       T01003                                 

Gene name
Gatm
Definition
(RefSeq) glycine amidinotransferase
  KO
K00613  glycine amidinotransferase [EC:2.1.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
Module
rno_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    81660 (Gatm)
   00330 Arginine and proline metabolism
    81660 (Gatm)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.1  glycine amidinotransferase
     81660 (Gatm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidinotransf
Motif
Other DBs
NCBI-GeneID: 81660
NCBI-ProteinID: NP_112293
RGD: 71090
Ensembl: ENSRNOG00000000168
UniProt: P50442
Position
3q35
AA seq 423 aa AA seqDB search
MLRVRCLRGGSRGAEAVHYIGSRLGGSLTGWVQRTFQSTQAATASSQNSCAAEDKATHPL
PKDCPVSSYNEWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPKDHL
KKAVAEVEEMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEII
EAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDRHKLAA
QGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
PMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSKWLSM
NVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQS
YFD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgctacgggtgcggtgtctgcgcggcggcagccgaggcgccgaggcggtgcactacatc
ggctctcggcttggaggatccttaacaggatgggtgcagcgaactttccagagcacccag
gcagctacagcttcctcccaaaattcctgtgcagctgaagacaaggccacccaccccctg
cccaaggactgccctgtctcctcttacaacgaatgggaccctttagaggaagtgatagtg
ggcagagctgaaaatgcctgtgtcccaccattcacagtggaggtgaaggccaatacatat
gaaaagtactggccgttttaccagaaaaatggaggtctttattttcccaaagatcatctg
aagaaggctgttgccgaggtcgaagagatgtgcaatattttatcaatggaaggcgtgacc
gtgaagcggcctgaccccattgactggtcactgaagtataagactcctgattttgagtct
acaggtttatacagcgcgatgcctcgagacatcctgatggttgtggggaatgagattata
gaggctcccatggcatggcgctcacgcttctttgagtaccgcgcatacaggtcaattatc
aaagactacttccaccgtggtgccaagtggacaacggcccccaagcccacaatggctgac
gaactgtatgaccaggactatcccatccattctgtggaagacagacacaaattggccgct
caggggaagttcgtgacaaccgagttcgagccttgctttgatgctgctgacttcattcga
gctggaagagatatttttgcgcagagaagccaggttacaaactacctgggcatcgagtgg
atgcgtaggcatcttgccccagactacagagtgcatatcatctcgtttaaagaccccaat
ccaatgcatattgatgccaccttcaacatcattggacctggtcttgtgctctccaaccct
gaccgtccatgccatcagattgatcttttcaagaaagcaggatggaccatagttacccct
ccaacacctgtgatccccgatgatcatcccctctggatgtcatccaagtggctctccatg
aatgtcttaatgctagatgagaagcgcgtgatggtagacgccaatgaggtcccaattcag
aagatgtttgagaagctgggtatcagcaccattaaggttaacattcgaaatgccaattcc
ctgggaggaggcttccactgctggacctgcgacgtccgccgccgaggcacccttcagtcc
tactttgactga

DBGET integrated database retrieval system