KEGG   Rattus norvegicus (rat): 81662
Entry
81662             CDS       T01003                                 

Gene name
Gna11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04270  Vascular smooth muscle contraction
rno04540  Gap junction
rno04725  Cholinergic synapse
rno04730  Long-term depression
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05142  Chagas disease
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    81662 (Gna11)
   04022 cGMP-PKG signaling pathway
    81662 (Gna11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    81662 (Gna11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    81662 (Gna11)
   04929 GnRH secretion
    81662 (Gna11)
   04912 GnRH signaling pathway
    81662 (Gna11)
   04935 Growth hormone synthesis, secretion and action
    81662 (Gna11)
   04928 Parathyroid hormone synthesis, secretion and action
    81662 (Gna11)
   04925 Aldosterone synthesis and secretion
    81662 (Gna11)
   04927 Cortisol synthesis and secretion
    81662 (Gna11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81662 (Gna11)
  09156 Nervous system
   04725 Cholinergic synapse
    81662 (Gna11)
   04730 Long-term depression
    81662 (Gna11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81662 (Gna11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    81662 (Gna11)
   05163 Human cytomegalovirus infection
    81662 (Gna11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    81662 (Gna11)
   05142 Chagas disease
    81662 (Gna11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81662 (Gna11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81662 (Gna11)
   04031 GTP-binding proteins [BR:rno04031]
    81662 (Gna11)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81662 (Gna11)
  Exosomal proteins of melanoma cells
   81662 (Gna11)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    81662 (Gna11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA RNPP_C AAA_29
Other DBs
NCBI-GeneID: 81662
NCBI-ProteinID: NP_112295
RGD: 619749
Ensembl: ENSRNOG00000005446
UniProt: Q9JID2
Position
7
AA seq 359 aa
MTLESMIACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAVVRAMDTLKIRYKYEQNKANALLIREVDVEK
VTTFEHQYVNAIKTLWSDPGVQECYDRRREFQLSDSAKYYLTDVDRIATVGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQHSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatagcgtgttgcctgagcgacgaggtgaaggagtcgaagcgc
atcaacgcggagatcgagaaacagctgcggcgagacaagcgcgacgcccggcgcgagctc
aagctgctgcttctcggcactggcgagagcgggaagagcaccttcatcaagcagatgcgc
atcatccatggcgccggctactcggaggaggacaaacgcggcttcacaaagctggtgtac
cagaacatcttcaccgccatgcaggctgtggtgcgcgctatggacacgctcaagatccgc
tacaagtatgagcagaacaaggccaatgcactcctgatccgggaggttgatgtggagaag
gtcacgacttttgagcatcagtatgtgaacgccatcaagacactgtggagtgaccctggt
gtccaggagtgctacgatcgcaggcgagagttccagctctctgactcggctaagtactac
ttgacggacgtggaccgcatcgctacagtaggctacctgcccacccagcaggatgtgctg
cgggtacgtgtgcccacaactggcatcatcgagtacccgtttgacctggagaacatcatc
ttcaggatggtggatgtgggcgggcagaggtcagagcgcaggaagtggatccattgcttt
gagaatgtcacgtccatcatgttcttggtggcattaagcgagtatgaccaggtcctggtg
gagtcggacaacgagaaccgcatggaggagagcaaggccctgttccgcacaatcatcacc
tacccctggttccagcactcgtctgtgatcctcttcctcaacaagaaggaccttctggaa
gacaagatcctgcactcacacttggtcgactacttccccgagttcgatgggccacagagg
gacgcacaggccgcccgcgagttcatcctgaagatgtttgtggatctgaaccccgacagc
gacaagatcatctactcgcacttcacctgcgccacggacaccgaaaacatccgcttcgtg
tttgctgccgtgaaggacaccatcctgcagctgaacctgaaggagtacaacctggtctga

KEGG   Rattus norvegicus (rat): 81666
Entry
81666             CDS       T01003                                 

Gene name
Gnaq
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04062  Chemokine signaling pathway
rno04071  Sphingolipid signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04916  Melanogenesis
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04929  GnRH secretion
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
rno05135  Yersinia infection
rno05142  Chagas disease
rno05143  African trypanosomiasis
rno05146  Amoebiasis
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    81666 (Gnaq)
   04371 Apelin signaling pathway
    81666 (Gnaq)
   04020 Calcium signaling pathway
    81666 (Gnaq)
   04071 Sphingolipid signaling pathway
    81666 (Gnaq)
   04022 cGMP-PKG signaling pathway
    81666 (Gnaq)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    81666 (Gnaq)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81666 (Gnaq)
   04062 Chemokine signaling pathway
    81666 (Gnaq)
  09152 Endocrine system
   04911 Insulin secretion
    81666 (Gnaq)
   04922 Glucagon signaling pathway
    81666 (Gnaq)
   04929 GnRH secretion
    81666 (Gnaq)
   04912 GnRH signaling pathway
    81666 (Gnaq)
   04915 Estrogen signaling pathway
    81666 (Gnaq)
   04921 Oxytocin signaling pathway
    81666 (Gnaq)
   04935 Growth hormone synthesis, secretion and action
    81666 (Gnaq)
   04918 Thyroid hormone synthesis
    81666 (Gnaq)
   04928 Parathyroid hormone synthesis, secretion and action
    81666 (Gnaq)
   04916 Melanogenesis
    81666 (Gnaq)
   04924 Renin secretion
    81666 (Gnaq)
   04925 Aldosterone synthesis and secretion
    81666 (Gnaq)
   04927 Cortisol synthesis and secretion
    81666 (Gnaq)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    81666 (Gnaq)
   04270 Vascular smooth muscle contraction
    81666 (Gnaq)
  09154 Digestive system
   04970 Salivary secretion
    81666 (Gnaq)
   04971 Gastric acid secretion
    81666 (Gnaq)
   04972 Pancreatic secretion
    81666 (Gnaq)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    81666 (Gnaq)
  09156 Nervous system
   04724 Glutamatergic synapse
    81666 (Gnaq)
   04725 Cholinergic synapse
    81666 (Gnaq)
   04728 Dopaminergic synapse
    81666 (Gnaq)
   04726 Serotonergic synapse
    81666 (Gnaq)
   04720 Long-term potentiation
    81666 (Gnaq)
   04730 Long-term depression
    81666 (Gnaq)
   04723 Retrograde endocannabinoid signaling
    81666 (Gnaq)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81666 (Gnaq)
  09159 Environmental adaptation
   04713 Circadian entrainment
    81666 (Gnaq)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81666 (Gnaq)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    81666 (Gnaq)
   05163 Human cytomegalovirus infection
    81666 (Gnaq)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    81666 (Gnaq)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    81666 (Gnaq)
   05142 Chagas disease
    81666 (Gnaq)
   05143 African trypanosomiasis
    81666 (Gnaq)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81666 (Gnaq)
   05016 Huntington disease
    81666 (Gnaq)
   05017 Spinocerebellar ataxia
    81666 (Gnaq)
   05022 Pathways of neurodegeneration - multiple diseases
    81666 (Gnaq)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81666 (Gnaq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81666 (Gnaq)
   04031 GTP-binding proteins [BR:rno04031]
    81666 (Gnaq)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81666 (Gnaq)
GTP-binding proteins [BR:rno04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    81666 (Gnaq)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 81666
NCBI-ProteinID: NP_112298
RGD: 620770
Ensembl: ENSRNOG00000014183
UniProt: P82471
Position
1
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggagg
atcaacgacgagatcgagcggcagctgcgcagggacaagcgcgacgcccgccgggagctc
aagctgctgctgctggggacaggggagagtggcaagagtaccttcattaagcagatgagg
atcatccacgggtcggggtactctgatgaagacaagaggggctttaccaaactggtgtat
cagaacatctttacagccatgcaggccatgatcagagctatggacactctcaagatccca
tacaagtatgaacacaataaggctcatgcacaattggttcgagaggttgatgtggagaag
gtgtctgcttttgagaatccatatgtagacgcaataaagagcttgtggaatgatcctgga
atccaggaatgctacgatagacggcgagaatatcagctatctgactctaccaaatactat
ctgaacgacttggaccgtgtggctgacccttcctatctgcctacacaacaagatgtgctt
agagttcgagtccccaccacagggatcattgagtaccccttcgacttacagagtgtcatc
ttcagaatggtcgatgtaggaggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaacgtcacctcgatcatgtttctggtagcgcttagcgaatacgatcaagttcttgtg
gagtcagacaatgagaaccgaatggaggagagcaaagcactctttagaaccattatcaca
tatccctggttccagaactcctctgttattctgttcttaaacaagaaagatcttctagag
gagaaaattatgtattcccacctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcacgagaattcatcctgaagatgttcgtggacctgaaccccgacagt
gacaaaatcatctactcgcacttcacgtgtgccacagacacggagaacatccgcttcgtg
tttgctgctgtcaaggacaccatcctgcagctgaacctgaaggagtacaatctggtgtga

DBGET integrated database retrieval system