KEGG   Rattus norvegicus (rat): 81668Help
Entry
81668             CDS       T01003                                 

Gene name
Gnrhr, GH1, Lhrhr
Definition
(RefSeq) gonadotropin releasing hormone receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81668 (Gnrhr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    81668 (Gnrhr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    81668 (Gnrhr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    81668 (Gnrhr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 81668
NCBI-ProteinID: NP_112300
RGD: 70513
Ensembl: ENSRNOG00000002011
UniProt: P30969
Position
14p21
AA seq 327 aa AA seqDB search
MANNASLEQDQNHCSAINNSIPLTQGKLPTLTLSGKIRVTVTFFLFLLSTAFNASFLVKL
QRWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAVTQPLAVQSKSKLERSMTSLAWILSIVFAGPQLYIFRM
IYLADGSGPAVFSQCVTHCSFPQWWHEAFYNFFTFSCLFIIPLLIMLICNAKIIFALTRV
LHQDPRKLQLNQSKNNIPRARLRTLKMTVAFATSFVICWTPYYVLGIWYWFDPEMLNRVS
EPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaatgcgtctcttgagcaggaccaaaatcactgctcagccatcaacaacagc
atccccctgacacagggcaagctcccgactctaaccttatctggaaagatccgagtgacg
gtgactttcttccttttcctactctctactgccttcaatgcctctttcttggtaaagctg
cagaggtggacccagaagaggaagaaaggaaaaaagctctcaaggatgaaggtgctttta
aagcatttgaccttagccaacctccttgagactctaatcgtcatgccgctggatgggatg
tggaacatcactgttcagtggtatgctggagagttcctttgcaaagttctcagctatctg
aagctcttctctatgtatgccccagccttcatgatggtggtgattagcctggatcgctcc
ctggccgtcactcagcccttagctgtccaaagcaagagcaagcttgaacggtctatgacc
agcctggcctggattctcagcattgtctttgcgggaccacagttatatatcttcaggatg
atctacctagccgacggctctgggccagcagttttctcgcaatgtgtgacccactgcagc
tttccgcaatggtggcatgaagccttctacaactttttcaccttcagctgcctgttcatc
atccctcttctcatcatgctaatctgcaatgccaaaatcatcttcgccctcacacgagtc
cttcatcaggacccacgcaaactacagctgaatcaatccaagaataatatcccaagagca
cggctgagaactctaaagatgacagtggcatttgccacctcctttgtcatctgctggact
ccctactacgtcctaggaatctggtactggtttgatccggaaatgttaaacagggtgtca
gagccagtcaatcacttcttctttctctttgcttttctaaacccgtgcttcgacccactt
atatatgggtatttctctttgtaa

DBGET integrated database retrieval system