KEGG   Rattus norvegicus (rat): 81673
Entry
81673             CDS       T01003                                 

Gene name
Gtf2b
Definition
(RefSeq) general transcription factor IIB
  KO
K03124  transcription initiation factor TFIIB
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno05017  Spinocerebellar ataxia
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    81673 (Gtf2b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81673 (Gtf2b)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    81673 (Gtf2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    81673 (Gtf2b)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     81673 (Gtf2b)
 Prokaryotic type
  Archaeal type
    TFB
     81673 (Gtf2b)
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon Cyclin_N Cyclin_C RB_B Sigma70_r4
Other DBs
NCBI-GeneID: 81673
NCBI-ProteinID: NP_112303
RGD: 619735
Ensembl: ENSRNOG00000011135
UniProt: P62916
Position
2q44
AA seq 316 aa
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PSDFKFDTPVDKLPQL
NT seq 951 nt   +upstreamnt  +downstreamnt
atggcgtcgaccagccgtttggatgctctcccacgagtcacatgtcccaatcatccagat
gcgattttagttgaggactacagagctggcgacatgatctgtcccgaatgcggcctagtt
gtaggggaccgggttattgatgtggggtctgaatggagaactttcagcaatgacaaagca
acgaaagacccatctcgagttggagactctcagaatcctcttctgagtgatggagatttg
tccaccatgattggcaagggtacaggagcggcaagttttgatgaatttggcaattctaag
tatcagaaccggagaacaatgagcagctctgatagagctatgatgaacgcattcaaggag
atcacgaccatggcagacagaatcaacctcccacgcaatatagttgatcgaacaaataat
ttattcaagcaagtatatgagcagaagagcctgaagggaagagctaatgatgcgatagct
tctgcttgtctgtacatcgcttgtagacaagaaggcgttcccaggacatttaaagaaata
tgtgctgtgtctcgaatctctaagaaagaaattggccgttgttttaaactgattttgaaa
gctttggagacgagcgtggatctgatcacaactggggacttcatgtccaggttctgctcc
aacctttgcctccccaagcaagtgcagatggcagctacacacatagcccgcaaggctgtg
gagctggacttggttcctggcaggagtcctatctctgtggcggcagcagctatttacatg
gcctcccaggcttcagctgagaagcgaacacagaaagaaatcggggatattgctggtgtt
gctgatgttacaatccgacagtcctacagactgatctaccctcgggctccagatctcttc
ccttcagacttcaagtttgacaccccagtggacaaattaccccagctataa

DBGET integrated database retrieval system