KEGG   Rattus norvegicus (rat): 81674
Entry
81674             CDS       T01003                                 

Gene name
Gtf2f2, Rap30
Definition
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    81674 (Gtf2f2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    81674 (Gtf2f2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     81674 (Gtf2f2)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     81674 (Gtf2f2)
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N
Other DBs
NCBI-GeneID: 81674
NCBI-ProteinID: NP_112304
RGD: 620772
Ensembl: ENSRNOG00000029316
UniProt: Q63489
Position
15q11
AA seq 249 aa
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMKLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGIQNVKGIHKNTWELKPEYR
HYQTEEKSD
NT seq 750 nt   +upstreamnt  +downstreamnt
atggcggagcgcggggaactcgatctgacgggcgccaaacagaacaccggcgtgtggctg
gtgaaggttcctaaatatttgtcccagcaatgggcaaaagcccctggaagaggtgaagtt
gggaaactgaggattgccaagaatcaaggaaggactgaggtatcatttactttgaatgag
gatcttgcgaatattcatgatatcggtgggaaaccagcttcagtcagtgctcctagagaa
catccatttgtcttgcaaagtgttggaggacagacattaacagtgttcaccgagagctcc
tcagataaactgtcattggaaggaatagtggttcagagagcggaatgccgacctgctgcc
agtgaaaactacatgaaactaaagagattgcaaatagaagaatcttccaaacctgtaagg
ctctcacaacagctggacaaagttgtaaccaccaattacaagcctgtcgctaaccatcag
tacaatattgaatatgaaaggaagaagaaagaagatggaaagcgagctcgggcagacaaa
caacacgtcctagacatgctgttctcagcctttgagaaacatcagtactataatcttaag
gacttggtggacatcacaaagcaacctgtgggatacctgaaagaaatcttgaaagaaatc
ggcattcagaatgtaaaaggaattcacaagaatacgtgggagctgaagccagagtacagg
cattaccaaacagaggagaagagcgactga

DBGET integrated database retrieval system