KEGG   Rattus norvegicus (rat): 81676
Entry
81676             CDS       T01003                                 

Gene name
Hnmt
Definition
(RefSeq) histamine N-methyltransferase
  KO
K00546  histamine N-methyltransferase [EC:2.1.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00340  Histidine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    81676 (Hnmt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81676 (Hnmt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.8  histamine N-methyltransferase
     81676 (Hnmt)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81676 (Hnmt)
SSDB
Motif
Pfam: Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_16
Other DBs
NCBI-GeneID: 81676
NCBI-ProteinID: NP_112306
RGD: 71049
Ensembl: ENSRNOG00000005223
UniProt: Q01984
Position
3p13
AA seq 295 aa
MASFMRSLFSDHSRYVESFRRFLNNSTEHQCMQEFMDKKLPGIIARIGETKAEIKILSIG
GGAGEIDLQILSKVQAQYPGICINNEVVEPNAEQIVKYKELVAKTSNMENIKFAWHKETS
SEYQKRVVEEDEEPPKWDFIHMIQMLYYVKDIPATLKFFHGLLAANAKILIILVSGTSGW
EKLWKKYGFRLPRDDLCQYVTSSDLAQILDDLGIKYECYDLLSTMDITDCFIDGNENGDL
LWDFLTETCNFIKTAPLDLKEEIMKDLQEPEFSVKKEGKVLFNNNLSFIVVEANV
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcatctttcatgaggagcttattttctgaccacagcagatatgttgaatcttttcgg
agatttctaaataattcaacggaacaccagtgcatgcaggaattcatggataagaagctt
ccaggcataatagcaaggattggagaaacaaaagcagaaattaagattctgagtataggc
ggaggtgcaggtgaaattgaccttcagattctctccaaagtccaggctcagtacccagga
atctgtattaacaatgaagttgtagagccaaatgccgaacaaattgtcaagtacaaagag
cttgtagcaaagacatcaaacatggagaacataaaatttgcttggcataaggagacatca
tctgaatatcaaaaacgtgtagtggaagaagacgaagaacctccaaagtgggactttatt
catatgattcagatgctatattatgtaaaggatatcccagccaccctgaaattcttccac
ggtctcttagctgccaatgctaaaattctcattattcttgtgtcaggaactagtggctgg
gaaaagctatggaaaaaatatggattccgcctacccagggatgacctctgccagtatgtc
acatcttctgatcttgctcagatactggacgacctgggtattaagtatgaatgttacgac
cttttgtccactatggacataacagactgttttattgatggtaatgaaaatggagacctg
ctttgggattttttgacagaaacctgcaactttatcaaaacagcaccactggacctcaaa
gaggaaattatgaaagatcttcaagagcctgaatttagtgttaagaaagaggggaaggta
cttttcaacaacaatctgagttttatagtggttgaggcaaatgtataa

DBGET integrated database retrieval system