KEGG   Rattus norvegicus (rat): 81678Help
Entry
81678             CDS       T01003                                 

Gene name
Itpr2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor, type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04070  Phosphatidylinositol signaling system
rno04114  Oocyte meiosis
rno04210  Apoptosis
rno04218  Cellular senescence
rno04270  Vascular smooth muscle contraction
rno04371  Apelin signaling pathway
rno04540  Gap junction
rno04611  Platelet activation
rno04621  NOD-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04720  Long-term potentiation
rno04723  Retrograde endocannabinoid signaling
rno04724  Glutamatergic synapse
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04728  Dopaminergic synapse
rno04730  Long-term depression
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno05010  Alzheimer disease
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    81678 (Itpr2)
   04020 Calcium signaling pathway
    81678 (Itpr2)
   04070 Phosphatidylinositol signaling system
    81678 (Itpr2)
   04022 cGMP - PKG signaling pathway
    81678 (Itpr2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    81678 (Itpr2)
   04210 Apoptosis
    81678 (Itpr2)
   04218 Cellular senescence
    81678 (Itpr2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    81678 (Itpr2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    81678 (Itpr2)
   04621 NOD-like receptor signaling pathway
    81678 (Itpr2)
   04625 C-type lectin receptor signaling pathway
    81678 (Itpr2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    81678 (Itpr2)
   04912 GnRH signaling pathway
    81678 (Itpr2)
   04915 Estrogen signaling pathway
    81678 (Itpr2)
   04921 Oxytocin signaling pathway
    81678 (Itpr2)
   04918 Thyroid hormone synthesis
    81678 (Itpr2)
   04928 Parathyroid hormone synthesis, secretion and action
    81678 (Itpr2)
   04924 Renin secretion
    81678 (Itpr2)
   04925 Aldosterone synthesis and secretion
    81678 (Itpr2)
   04927 Cortisol synthesis and secretion
    81678 (Itpr2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    81678 (Itpr2)
  09154 Digestive system
   04970 Salivary secretion
    81678 (Itpr2)
   04971 Gastric acid secretion
    81678 (Itpr2)
   04972 Pancreatic secretion
    81678 (Itpr2)
  09156 Nervous system
   04724 Glutamatergic synapse
    81678 (Itpr2)
   04725 Cholinergic synapse
    81678 (Itpr2)
   04728 Dopaminergic synapse
    81678 (Itpr2)
   04726 Serotonergic synapse
    81678 (Itpr2)
   04720 Long-term potentiation
    81678 (Itpr2)
   04730 Long-term depression
    81678 (Itpr2)
   04723 Retrograde endocannabinoid signaling
    81678 (Itpr2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    81678 (Itpr2)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    81678 (Itpr2)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    81678 (Itpr2)
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    81678 (Itpr2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    81678 (Itpr2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    81678 (Itpr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    81678 (Itpr2)
Ion channels [BR:rno04040]
 Ligand-gated channels
  IP3 receptor
   81678 (Itpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 81678
NCBI-ProteinID: NP_112308
RGD: 69649
UniProt: P29995
Position
4q44
AA seq 2701 aa AA seqDB search
MSDKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLTNPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEIVKYSKV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNVELLDNPGCKEVNAVNCNTSWKITLFMKFSSYREDVLKGGDVV
RLFHAEQEKFLTCDDYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKTVRDGELPTSKKKHQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTEEERPVMLKIGTC
QTKEDKEAFAIVCVPLSEVRDLDFANDANKVLATTVKKLENGSITQNERRFVTKLLEDLI
FFVADVTNNGQDVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYVLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNSTAIPVTQELICKFMLSPG
NADILIQTKLVSMQVENPMESSILPDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAREGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGSNNVMRTIHGVGEMMTQMVLSRGSIFPVSWPDAQPSVHPSKQASPGE
QEDVTVMDTKLKVIEILQFILSVRLDYRISYMLSIYKKEFGENDGNGDPSASGTPETLLP
SALVPDIDEIAAQAETMFAGRKEKTPVQLDDEGGRTFLRVLIHLIMHDYAPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSGSYENGD
MGEGQAKGGEEANEESNLLSPVQDGAKTPQIDSNKGNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKTDEKMNEVMDLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLNMMCSERARGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLERCVTESVMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRALAEVAKNRGIAIPVDLDSQVN
TLFMKNHSSTVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEQQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFMEESSTLRKILLNRYFKGDHSVGVNGPLSGAYAKTAQVGGGFTGQDADKTGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQNSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGSKKREEDSDLMALGPRMRVRDSSLHLK
EGMKGQLTEASSATSKAYCVYRREMDPDIDTMCPGQEAGSAEEKSAEEVTMSPAITIMRP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILSDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPKELVDVMKNAYNQGLECNHGDEEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPEEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEFLTRESKYRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSALLWVAVAICTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGNDGVPTMTLTSMLGTCPKENCSPT
IPSSNAAGEGGEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKKEKILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMITEKNLDWFPRMRAMSLVSNEGD
SEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHENHHMPP
H
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaaatgtccagcttcctctacattggggacatcgtgtccctgtacgcggag
ggctcggtcaatggcttcatcagcaccctggggttggtggatgaccgttgtgtggtgcac
ccggaggcgggggatcttaccaacccacccaagaagttcagagactgcctcttcaaggtg
tgccccatgaatcgatactctgcccagaagcagtactggaaagccaagcaggcgaagcag
ggaaaccacacggaggctgccctgctgaagaagctccagcacgccgcagagctggaacaa
aaacagaatgagtcagagaacaggaaacttttgggagaaattgtgaaatacagcaaagtt
atacaactactgcacataaaaagcaacaagtacctcaccgtgaacaagaggttacctgcc
ttactggagaagaatgccatgcgtgtgtccctggatgctgcagggaacgaagggtcctgg
ttctacatccatcccttctggaagctgagaagcgagggtgataatatcgtcgtgggagat
aaagtcgttctgatgcctgtaaatgctgggcagcccctgcatgccagcaacgtggagctc
ctggacaaccccggctgcaaagaggtgaatgctgttaattgcaacactagctggaaaatc
actttattcatgaagttcagctcctaccgagaggatgtattaaaagggggtgacgttgtg
agactgtttcatgcggaacaagagaagtttctgacctgtgatgactatgagaaaaaacag
cacattttcctgcggacgaccttgcgtcaatcagcaacgtcggccactagctctaaagca
ctctgggagatagaggtggttcaccatgatccatgccgcggaggtgcaggacagtggaac
agcctgttcaggtttaagcatcttgcaactgggaactacttagctgcagagcttaaccct
gactatcgagatgctcaaaatgaaggaaaaactgtgagagacggggagcttccaacctca
aagaaaaaacaccaggcaggggagaagatcatgtacacgctggtctcggtcccgcacgga
aatgacatcgcgtccctttttgaacttgacgccacaactctgcagagagctgactgcctg
gttccgaggaactcctacgtgcggttgaggcacctgtgtaccaacacgtgggtaacaagc
accagcatccccatagacacggaggaagagaggcctgtcatgctgaaaattgggacctgc
cagaccaaggaagacaaagaagcctttgccatcgtgtgcgtcccgctgtctgaggtccga
gacctggactttgccaacgatgccaacaaagtgttggccaccacggtgaagaagctggag
aacggcagcatcacccagaatgagaggaggtttgtgactaagttgttggaagaccttatt
ttctttgtggctgatgtgaccaacaacggacaggatgttctggatgtggtcatcaccaag
cccaaccgggaacggcaaaaactaatgagggaacagaatattctggcacaggtgtttggg
atccttaaagcccctttcaaggagaaggctggggaaggctcgatgctgaggctggaggac
ctgggcgaccagcgctatgccccgtacaagtacgtgctgcgtctctgctaccgtgtgctg
aggcattcgcagcaggactacaggaagaaccaggagtacattgctaagaacttctgcgtc
atgcagtctcagatcggctatgatattttggcagaagatacgatcacagccttgctacac
aacaaccgcaaactcctggagaaacacatcacggccaaagaaatcgagaccttcgtcagc
ctgctcaggaggaaccgggagccgaggtttctggactatctgtctgacctctgcgtgtcc
aatagcaccgccatccctgtgactcaggagctcatctgcaaattcatgctgagccccggc
aatgcggacatcctcattcagacgaagctggtgtccatgcaagtggaaaaccccatggag
agctccatccttcccgatgacatcgacgacgaggaggtttggctttactggattgacagc
aacaaggagcctcacggcaaggccatcaggcacctggcccaggaggccagggaaggcacc
aaggctgacctagaagtcctgacctattacaggtaccagctaaacctctttgcaaggatg
tgcttggaccgccagtacctggccatcaaccagatttcaacacagctgtctgtagacctg
atcctgcggtgcgtgtctgacgagagcctgccctttgacctccgagcctctttctgccga
ctcatgctccacatgcatgtggaccgggacccccaggagtctgtggtgcctgtccgctac
gcccggctctggactgagatccccaccaagatcacgatccatgagtatgactccatcaca
gactcttccagaaatgacatgaagaggaagtttgccctgacaatggaatttgtcgaagaa
tatttgaaagaagttgtgaatcaaccgtttccttttggggacaaagagaaaaataaactg
acatttgaggtggtccacctggcccggaacctcatctacttcggattctacagcttcagc
gagttgctgcggctgacgagaactctgctggcgatcctggacatcgtccaggcccccatg
tcgtcgtattttgaaagattaagcaagtttcaagatggaagcaacaatgtcatgaggacc
atccacggggtgggagagatgatgacacagatggtgctcagcagaggctccattttccca
gtgagctggcccgacgcacagcccagcgtccaccccagcaagcaggcgagccccggcgag
caggaggatgtgacggttatggataccaagctaaaggttatcgagattttacagttcatc
ctgagtgtcaggctggactaccgtatctcttacatgctgtccatatacaagaaggaattt
ggggagaatgatggcaacggtgacccctctgccagcggcaccccggaaacattgctacca
tcagctcttgtccctgacattgatgagattgcggctcaggcagaaacgatgtttgctgga
agaaaagaaaaaactccagttcagcttgatgatgagggaggcagaaccttcttaagagtc
ctcatccacctgatcatgcatgactatgctccactgctgtccggggccctgcagctgctg
ttcaaacacttcagccagagagcagaagtgcttcaggccttcaaacaggtgcagttactg
gtgtcgaaccaagatgtcgataactacaagcaaatcaaggcagacctggaccaacttcgg
ctgacggtggagaagtccgagctatgggtggaaaagagcggcagctatgagaatggagac
atgggcgagggccaggccaaaggaggcgaagaggcaaacgaggagtccaacctcttgagc
ccggtgcaggacggcgcgaagacacctcagatcgacagcaacaagggcaacaactaccgg
atcgtcaaggagatcttgattaggctgagtaagctctgtgtgcagaacaagaaatgtcgt
aatcaacaccaacggttgctgaaaaatatgggggctcactccgtggtactggaccttctg
cagatcccctatgagaagaccgacgagaagatgaacgaggtgatggacttagcccacacc
ttcctgcagaacttctgccgcgggaatccacagaaccaagttctccttcacaagcatctc
aacctgttcctaacccctggactcctggaggcggaaaccatgcggcacatcttcatgaac
aattaccatctgtgcaatgagatcagcgagagggtggtccagcactttgtgcactgcatt
gagacacacggccgccacgtggagtacctgaggttcctgcagaccatcgtgaaagcagac
ggcaaatacgtgaagaaatgccaggacatggtgatgaccgagctgatcaatgggggtgaa
gacgtactgatattctacaacgaccgagcctcatttcccatccttctcaacatgatgtgc
tccgagagagcccgtggggatgagagcggccccctggcctaccatatcacccttgtggag
ttgctggcagcgtgcactgaggggaagaacgtctacacggagatcaagtgcaattctctc
ttgcctctggacgacatagtgagggtggtgacccacgacgactgcattcctgaggtaaaa
attgcatacgtgaactttgtcaaccattgttacgttgacacagaagtggagatgaaggaa
atctatacaagtaaccacatttggaagttatttgagaacttcttggtggatatggcaagg
gtctgcaacaccaccacggaccggaaacacgcagacacctttctggagaggtgtgtgaca
gagtcagtcatgaacatcgtgagcggcttcttcaactcgccgttttcggataacagtacc
agcctccagacccatcagccggtctttatccagctgctgcagtccgccttcagaatttac
aactgcacctggcccaacccagcccagaaagcctccgtggaatcctgcatcagagccctg
gctgaagtggccaaaaaccgtgggattgcgattccggtggatttggacagccaggtcaac
acactcttcatgaagaatcactcaagtacagtgcagagggcggccatgggctggaggctc
tctgctcgctccggacctcgcttcaaggaagctcttggagggccagcatgggactacagg
aatattattgaaaagttacaggatgtcgtggcctctctggaacagcagttcagccccatg
atgcaggctgagttctctgtgcttgtggatgtgctgtacagcccggagctactgttccca
gaaggaagcgatgccaggatacgatgtggtgccttcatgtccaagctgattaatcacaca
aagaaactgatggaaaaagaagaaaaactgtgcattaaaatcctccagacgttacgggag
atgctggagaagaaagacagcttcatggaagagagtagcacattacggaaaatcctcctg
aatcggtacttcaagggtgaccacagcgttggtgtgaacggacctctgtcaggagcctac
gccaagacagcacaagtgggagggggcttcactggacaggatgccgataagacggggatt
tccatgtccgatatccagtgtttgctggacaaggaaggggcctccgaacttgtcatcgat
gtcattgtgaacaccaaaaacgacaggattttttccgagggcatcttgcttggcattgcc
ctgctggaaggaggaaacacacaaacccagaattctttctaccagcagttgcatgaacaa
aaaaagtcagagaaattcttcaaagtcctttacgatcggatgaaggctgctcagaaagag
atcagatccacggtgactgtcaacaccatagacttagggagcaagaagagagaggaggac
agtgacctcatggccttgggccctcggatgagagtgagagactcatcgctgcatttgaaa
gagggaatgaaagggcagttgactgaggcgtcttcagccacgtccaaagcatactgtgtg
tacagaagggaaatggacccagacattgacacgatgtgcccgggacaggaagcaggaagt
gcggaggaaaagtctgcagaggaagttaccatgagcccagccatcactatcatgcggccc
atcctcaggttcctgcagttactgtgtgagaatcacaaccgggagcttcagaacttcttg
aggaaccagaacaacaaaacaaactacaaccttgtctgtgaaacacttcagtttctggac
tgcatctgtggaagcaccacagggggcctaggcctgctggggctctacatcaatgagaag
aacgtagctctggtcaaccagaccctggagagcttgaccgagtactgccagggcccgtgt
catgagaaccagacctgtatcgccactcacgaatccaatgggattgacatcatcatcgcc
ttgattctgagtgacatcaaccctctgggcaagtacagaatggacctggtgctacagctg
aagaacaacgcctccaagcttctgctggccattatggagagcagacacgacagtgagaat
gcagagagaattctcttcaacatgagacccaaggaactggtggatgtcatgaagaatgcc
tataaccaaggcctggaatgtaaccatggggacgaggagggaggagatgatggtgtttct
ccaaaagacgttggacacaacatctacatcctggcccatcagttggcccgccacaataaa
ctcctacagcagatgctcaagcctggatccgatccagaggaaggggatgaagccttgaag
tactatgccaaccacaccgcacagatcgagattgtgcggcacgaccggactatggagcag
attgttttccccgtccccaatatctgcgaattcctcactcgggaatccaaataccgggtg
ttcaacacaacggagagggatgagcaaggaagcaaggtgaacgacttcttccagcaaacg
gaagatctctacaacgagatgaaatggcaaaagaagatcaggaacaaccccgccctgttc
tggttctccaggcacatctccctgtgggggagcatctccttcaacctggctgtgttcatc
aacctggccgtggctctcttctacccattcggggatgacggcgatgaaggtacgctctcc
ccgctgttctcagccctcctttgggtagcagtggcgatctgcacgtctatgctgttcttc
ttctccaagcctgtgggcatccggccattccttgtgtctatcatgctcagatcaatatac
accatcggtctggggccaacgctaatacttcttggtgctgccaatctatgcaataaaatc
gtgttcctggtgagttttgtgggaaaccgaggcacattcacccgagggtaccgagcagtc
attctggacatggcctttctttaccacgtggcctatgtcttggtttgcatgcttggcctc
ttcgtccacgagttcttctacagcttcctgctttttgacttggtgtacagagaagagacc
ctgctgaacgtcatcaaaagcgtcacacggaatggccgctccatcatcctgactgcggtc
ttggctcttatcctggtctacctgttctccatcatcggcttccttttcttaaaggatgac
ttcaccatggaggtggacagattgaaaaacagaactccagtcacaggtaacgacggggtt
cccactatgaccttaacttccatgctgggaacctgccctaaggaaaactgctcacccacg
atcccctcttcgaatgcagccggtgagggaggtgaggacggcatcgagaggacctgtgac
accctgctcatgtgcattgtcaccgtgctgaaccagggcctcaggaatggtggcggagtt
ggtgacgtgctgagacgaccctcgaaggatgagcctttgtttgctgcccgggtggtctac
gacctccttttcttcttcatcgtcatcatcatcgtccttaacctgatttttggtgtaatc
attgacactttcgctgacctcaggagtgagaagcagaagaaagaaaaaattctcaagaca
acctgcttcatctgtggcttggagagggacaagtttgataacaagacggtgtcctttgag
gagcacatcaagtcagagcacaacatgtggcattacttgtacttcatcgtcctggtgaag
gtgaaggacccaacagaatacacagggcctgagagctacgtggctcagatgatcacagag
aagaatttagactggtttcctcggatgcgagccatgtcacttgtcagcaatgaaggtgac
agtgagcaaaatgagatccggaacctgcaggagaagctggagtccactatgagtctggtg
aaacagttgtcggggcagctggcagagctgaaggagcagatgacagaacaaaggaaaaac
aagcaaaggctgggcttccttggatcaaacacaccccatgagaaccatcacatgccaccg
cactga

DBGET integrated database retrieval system