KEGG   Rattus norvegicus (rat): 81679Help
Entry
81679             CDS       T01003                                 

Gene name
Jup
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81679 (Jup)
   05202 Transcriptional misregulation in cancer
    81679 (Jup)
  09162 Cancer: specific types
   05226 Gastric cancer
    81679 (Jup)
   05221 Acute myeloid leukemia
    81679 (Jup)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    81679 (Jup)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81679 (Jup)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81679 (Jup)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT V-ATPase_H_N Cnd1 HEAT_2 Adaptin_N Atx10homo_assoc DUF3361 PUL
Motif
Other DBs
NCBI-GeneID: 81679
NCBI-ProteinID: NP_112309
RGD: 620412
Ensembl: ENSRNOG00000015380
UniProt: Q6P0K8
Position
10q31
AA seq 745 aa AA seqDB search
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGLLDEDDTCGRQYTLKKTTT
YTQGVPQSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLENVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLDMHMDM
DGDYPMDTYSDGLRPPYPAADHMLA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgatgaaccttattgaacagcccatcaaggtgacggagtggcagcagacgtac
acctatgactcgggcatccactccggtgtcaatacctgtgtgccctctgtcagcagcaag
ggcctcctcgatgaggatgacacctgcggcagacagtacacactcaagaaaactaccacc
tacacacaaggggtgccacagagccaaggcgacctggagtaccagatgtccaccacggcc
agagccaagcgggtgcgggaggccatgtgcccaggtgtctcaggcgaggacagttctctc
ctcctggccacccaggtggaggggcagacgaccaacctgcagcgactggccgaaccatcc
cagctactcaagtcggccattgtacatctcatcaactaccaggacgacgcagagctggcc
acccgggctctgcctgagctcaccaagctgctcaacgatgaggacccggtagtggtcacc
aaggcggctatgatcgtgaaccagctgtccaagaaggaggcatcccgccgtgccctgatg
ggctcgccccagctggtggcggctgtggtgcggaccatgcagaacaccagtgacctggat
actgcccgctgtaccaccagcatcctgcacaacctctcccaccaccgagaggggctgctt
gctatcttcaagtctggaggcatccccgccctggtccgaatgctcagttcccccgtagag
tctgtcctgttctacgccatcaccacactgcacaacctgctgctctaccaggagggcgcc
aagatggcggtgcgtctggcagacggactgcagaagatggtgcccctacttaacaagaac
aaccccaaattcctggccatcaccaccgactgcctgcagctcctggcctatggcaaccag
gagagcaagctgatcatcctggccaatgggggaccccagggtcttgtgcagatcatgagg
aactacagctacgagaagcttctgtggaccaccagccgggtgctcaaggtgctctccgtg
tgccccagcaacaagcctgccatcgtggaggctggtgggatgcaggctctaggcaagcac
ttgacaagcaacagcccccgcctggtgcagaactgcctgtggactctgcgcaatctctcg
gatgtggccaccaagcaggagggcctggagaacgtgctgaagatcctggtcaatcagctg
agcgtggatgatgtcaacgtcctcacctgtgccacgggcaccctctccaacctgacctgc
aacaacagcaaaaacaagacgctggtgacgcagaacagtggcgtggaggcgctcatccac
gccatcctcagagccggagacaaggacgacatcacagagcccgccgtttgcgccctgcgc
caccttaccagccgccaccctgaggctgagatggcccagaactctgtgcgcctcaactat
ggaatcccggccattgtgaaactgctcaaccagccgaaccagtggccactggtcaaggca
actatcggcctgatccggaacctggctctgtgccccgccaatcatgccccgctgcaggag
gccgcggtcattccccgcctcgttcagctgctggtcaaggcccaccaggatgcccagcga
catgtagctgcgggcacccagcagccctacacggatggtgtgaggatggaggagatcgtg
gagggctgcaccggagccctgcacatcctcgcccgagatcccatgaaccgcatggagatc
ttccggctcaacaccattcccctgtttgtccagctcctgtattcctctgtggagaacatc
cagcgtgtggctgccggagtgctgtgcgagctggcccaggacaaggaggctgccgatgcc
atagacgcggagggcgcctctgcccctctcatggaactgctccactcccgcaatgagggg
accgcgacctacgctgctgctgtcctgttccgcatctccgaggacaagaacccagattac
cgtaagcgagtgtctgtggaactcaccaactcgctcttcaagcatgacccagctgcctgg
gaggctgcccagagcatgatcccgatcaacgaaccctatgcagacgacatggatgcaacc
taccgccccatgtactccagcgatgtgcctctggaccccctggatatgcacatggacatg
gatggcgactaccccatggacacctacagcgacggcctgagacctccctaccccgctgca
gaccacatgctggcctag

DBGET integrated database retrieval system