KEGG   Rattus norvegicus (rat): 81681Help
Entry
81681             CDS       T01003                                 

Gene name
Lss
Definition
(RefSeq) lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase)
  KO
K01852  lanosterol synthase [EC:5.4.99.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00100  Steroid biosynthesis
rno01100  Metabolic pathways
Module
rno_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    81681 (Lss)
Enzymes [BR:rno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.7  lanosterol synthase
     81681 (Lss)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement
Motif
Other DBs
NCBI-GeneID: 81681
NCBI-ProteinID: NP_112311
RGD: 620955
Ensembl: ENSRNOG00000054549
UniProt: P48450
Position
20p12
AA seq 733 aa AA seqDB search
MTEGTCLRRRGGPYKTEPATDLTRWRLHNELGRQRWTYYQAEEDPGREQTGLEAHSLGLD
TTSYFKNLPKAQTAHEGALNGVTFYAKLQAEDGHWAGDYGGPLFLLPGLLITCHIAHIPL
PAGYREEMVRYLRSVQLPNGGWGLHIEDKSTVFGTALSYVSLRILGIGPDDPDLVRARNI
LHKKGGAVAIPSWGKFWLAVLNVYSWEGINTLFPEMWLLPEWFPAHPSTLWCHCRQVYLP
MSYCYATRLSASEDPLVQSLRQELYVEDYASIDWPAQKNNVCPDDMYTPHSWLLHVVYGL
LNLYERFHSTSLRKWAIQLLYEHVAADDRFTKCISIGPISKTVNMLIRWSVDGPSSPAFQ
EHVSRIKDYLWLGLDGMKMQGTNGSQTWDTSFAVQALLEAGAHRRPEFLPCLQKAHEFLR
LSQVPDNNPDYQKYYRHMHKGGFPFSTLDCGWIVADCTAEALKAVLLLQERCPSITEHVP
RERLYDAVAVLLSMRNSDGGFATYETKRGGYLLELLNPSEVFGDIMIDYTYVECTSAVMQ
ALRHFREYFPDHRATEIRETLNQGLDFCRKKQRADGSWEGSWGVCFTYGTWFGLEAFACM
GHIYQNRTACAEVAQACHFLLSRQMADGGWGEDFESCEQRRYVQSAGSQVHSTCWALLGL
MAVRHPDISAQERGIRCLLGKQLPNGDWPQENISGVFNKSCAISYTNYRNIFPIWALGRF
SSLYPDNTLAGHI
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagggcacgtgtctgcggcgtcgtgggggaccctataaaactgagcccgccacc
gatctcacccgctggcggctccataatgagttgggtcggcagagatggacttattatcaa
gcggaggaggaccctggtcgagaacagacggggctagaggcccactctttgggactggac
acaacaagttatttcaagaacttacctaaagctcaaacagcccatgagggggccctgaac
ggagtaaccttttatgccaagctgcaggctgaggatggacactgggctggtgattatggt
ggtccactcttcctcttgccaggtctcctgattacgtgtcacatagcacacatccccctg
ccggctggatacagagaggaaatggtacggtacttgcgctcagtgcagcttcccaatggc
ggctggggcttgcacattgaggacaagtccacggtgtttgggactgccctgagctatgtg
tctctcagaatcctgggtattggacctgatgatcctgaccttgtgcgtgctcggaacatt
cttcacaaaaaaggtggtgcagtggccatcccttcctgggggaagttctggctggctgtc
ctgaatgtttacagctgggaaggaatcaataccctcttccctgagatgtggctgcttcct
gaatggtttcctgcacatccctccactctgtggtgtcactgccggcaggtctatctgccc
atgagctactgctacgccactcggctaagtgcctcagaggacccactggttcagagcctc
cgccaggaactctatgtggaggattatgccagcatcgattggccagcacagaagaacaac
gtgtgccccgatgacatgtacacgccacacagctggctgctgcacgtggtatatggactc
ctcaacctgtatgaacgtttccacagtaccagcctgcggaagtgggccatccagttgctg
tatgaacatgtcgcagctgatgatcggttcacgaaatgcatcagcattggcccgatctca
aaaactgtcaacatgcttattcgttggtcagtggacggaccatcctcccctgccttccag
gagcacgtctcgaggatcaaagattatctttggctgggccttgacggcatgaaaatgcag
ggcaccaatggatcacagacctgggacacttcatttgctgtccaagccctgctggaggca
ggtgcacaccgaagacctgagtttttgccctgcctgcagaaggctcacgagttcctgcgg
ctttcccaggtcccagacaacaatcctgactaccagaagtattatcgccatatgcacaag
ggtggtttccccttcagcacactggactgtggctggatcgttgctgactgcacggccgag
gctttgaaggctgtgctgctcctgcaggagcggtgtccctcaatcaccgagcatgtcccc
cgagagcgactctacgatgctgtggctgtgttgttgagcatgaggaattccgatggaggg
tttgctacctatgagactaagcgtggcgggtatttgctggagctgctgaacccctcagag
gtctttggagacatcatgattgactacacgtatgtagagtgtacctccgcagtgatgcag
gccctgaggcacttccgcgagtacttcccagaccacagggctacagagatcagggagacc
ctcaatcaaggcctggacttctgccgaaagaagcagagagcggatggctcgtgggagggc
tcctggggggtttgcttcacctatggcacctggtttggcttggaagcattcgcttgcatg
ggacatatctaccaaaataggactgcttgtgcagaagtagctcaggcctgccacttcctc
ctgtcgcggcagatggcggatgggggctggggggaggactttgagtcctgtgagcagcgg
cggtacgtgcagagtgccgggtcccaggtccatagtacgtgctgggccctgctgggtttg
atggctgtcaggcatcccgacatctctgctcaggagagaggaatcagatgtctgctaggg
aaacagctccccaacggagactggcctcaggagaacatctctggggtcttcaacaagtcc
tgtgccatcagctacacaaattacagaaacatcttccccatctgggccctgggccgcttc
tccagcctgtatcctgacaatacccttgctggccacatttga

DBGET integrated database retrieval system