KEGG   Rattus norvegicus (rat): 81682Help
Entry
81682             CDS       T01003                                 

Gene name
Lum
Definition
(RefSeq) lumican
  KO
K08122  lumican
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    81682 (Lum)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    81682 (Lum)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    81682 (Lum)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_6 LRR_9 LRRNT LRR_5
Motif
Other DBs
NCBI-GeneID: 81682
NCBI-ProteinID: NP_112312
RGD: 620984
Ensembl: ENSRNOG00000004610
UniProt: P51886
Position
7q13
AA seq 338 aa AA seqDB search
MNVCTFTLVLALVGSVSGQYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKK
LHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASL
KGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNE
LADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGP
LSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtatgtacgttcactcttgtcttggcattagtcggtagtgtcagtggccaatac
tatgattatgatgcccctctcttcatgtatggggaactgtcacccaactgtgcaccagaa
tgtaactgtccccacagctacccaactgccatgtactgtgatgatctcaagttgaaaagt
gtgcccatggtgccccctggcatcaagtacctttacctgaggaataaccagatcgaccat
attgatgaaaaggcctttgagaatgtaacggatctgcagtggctcattcttgaccacaat
cttctagaaaactccaagatcaaaggaaaggtcttctctaagctgaaacaactgaagaag
ctgcatataaactacaacaatttgaccgagtccgtgggtccgctcccaaagtccctacaa
gaccttcagctggccaataataagatcagcaagctgggctccttcgacgggctggtaaac
ctgaccttcatttaccttcaacacaaccagctcaaagaggaggctgtctcggcttctctg
aaaggccttaagtcactcgaatacctcgacttgagcttcaatcagatgagcaagctgccc
gctggccttccaacatctcttctaactctctacctagacaacaataagatcaccaacatt
cctgatgagtatttcaatcgcttcaccgggcttcaatacttgcgtttatctcacaatgag
ctggctgacagtggcgtgcctggaaactcatttaacatatcatctctgctcgagctcgat
ctctcctacaataagctcaagagtataccaaccgttaatgaaaaccttgaaaactattac
ctggaggtcaataaactcgaaaagtttgatgtcaagagcttctgtaagatcctgggacca
ctatcttactccaagatcaagcatttgcgcttggatggcaatcccctcactcaaagcagt
ctgccccctgacatgtacgagtgtctacgtgtagcaaatgaaatcacggttaattaa

DBGET integrated database retrieval system