KEGG   Rattus norvegicus (rat): 81683Help
Entry
81683             CDS       T01003                                 

Gene name
Mif
Definition
(RefSeq) macrophage migration inhibitory factor (glycosylation-inhibiting factor)
  KO
K07253  phenylpyruvate tautomerase [EC:5.3.2.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00350  Tyrosine metabolism
rno00360  Phenylalanine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    81683 (Mif)
   00360 Phenylalanine metabolism
    81683 (Mif)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81683 (Mif)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.2  Interconverting keto- and enol-groups
    5.3.2.1  phenylpyruvate tautomerase
     81683 (Mif)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   81683 (Mif)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIF
Motif
Other DBs
NCBI-GeneID: 81683
NCBI-ProteinID: NP_112313
RGD: 621163
Ensembl: ENSRNOG00000006589
UniProt: P30904 A0A0F7RQL3
Structure
PDB: 

Position
20p12
AA seq 115 aa AA seqDB search
MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTSDPCALC
SLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgttcatcgtgaacaccaatgttccccgcgcctccgtgccagaggggtttctc
tccgagctcacccagcagctggcgcaggccaccggcaagccggcacagtacatcgcagtg
cacgtggtcccggaccagctcatgacttttagtggcacgagcgacccctgcgccctctgc
agcctgcacagcatcggcaagatcggtggcgcccagaaccgcaactacagcaagctgctg
tgcggcctgctgtccgatcgcctgcacatcagcccggaccgggtctacatcaactattac
gacatgaacgcagccaacgtgggctggaacggttccaccttcgcttga

DBGET integrated database retrieval system