KEGG   Rattus norvegicus (rat): 81684Help
Entry
81684             CDS       T01003                                 

Gene name
Mipep
Definition
(RefSeq) mitochondrial intermediate peptidase
  KO
K01410  mitochondrial intermediate peptidase [EC:3.4.24.59]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81684 (Mipep)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    81684 (Mipep)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.59  mitochondrial intermediate peptidase
     81684 (Mipep)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M3
   81684 (Mipep)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    81684 (Mipep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3 Peptidase_M91
Motif
Other DBs
NCBI-GeneID: 81684
NCBI-ProteinID: NP_112314
RGD: 621680
Ensembl: ENSRNOG00000013876
UniProt: A0A0G2K4T8
Position
15p12
AA seq 711 aa AA seqDB search
MLLAAGTRYAYRLCGRRAAAALQGHAGRSCARSVSTSWSPVGAAFNVKPQGHLWDLLGER
RGLFGVPELSTPEGFQVAQEEALRKTEWLVERACSTPPGPQTVLIFDELSDCLCRVADLA
DFVKIGHPEQAFREAAQEACRSIGTMVEKLNTNVELYQSLQKLLDDKKLMDSLDAETRRV
AELFMFDFEISGIHLDEEKRRRAVDLNVKILDLSSAFLMGTNFPIKIQKHLLPEHIQHHF
ARDGRHLVIDGLHAEASDDLVREAAYKIFLYPNADQLKCLEELLSSRDLLANLVGYSTFS
HRALQGTIAQTPETVMQFLEKLSEKLCERTRKDFEMMQGMKTKLNPQNSELMPWDPPYYS
GVIRAERYNIEPSLYCPFLSLGACMEGLNVLFNRLLGVTLYAEQPFKGEVWCIDVRKLAV
VHESEGLLGYIYCDFFQRANKPQQDCHFTIRGGRLKEDGSYQLPVVVLMLNLPHASRDFP
TLLTPGMMENLFHEMGHAMHSMLGRTRYQHVTGTRCPTDFAEVPSILMEYFSNDYRVVSQ
FAKHYQTGQPLPKAMVSRLCESKKVCAAAEMQLQVFYAALDQIYHGQHPLKKSTTDILME
TQEQFYGLPYVPDTAWQLRFSHLVGYGAKYYSYLMSRAVASMVWKECFLQDPFNRAAGER
YRREMLAHGGGKEPMLMIQGMLQKCPSIDDFVDALVSDLNLDFETFFMDSK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggcagccgggacgcggtatgcctaccggctgtgcggccggcgagccgcggcg
gctctgcagggacacgcaggccggagctgcgcccggagcgttagcactagctggtccccg
gtgggcgctgcctttaacgtcaagccccagggccacctgtgggacctgttgggagagcga
cggggtctttttggagttcctgagctcagcacccctgaaggattccaagttgcccaggag
gaagccttgaggaagacggagtggctggtagagcgagcatgttccacacctccagggcca
cagacagtcctcattttcgatgagctctcggattgcctctgcagagtggctgacttggcg
gactttgtgaaaattggacacccagagcaggcgttcagagaggctgcgcaggaggcctgc
agaagtattggcaccatggtggaaaagttgaatacgaatgtggaattgtatcagagtctg
cagaaattactagatgacaagaagcttatggattcccttgatgcagaaaccaggcgagta
gccgaactatttatgtttgattttgaaatcagtggaatccatctagatgaagaaaagcgc
agaagagccgtggacctcaatgttaagatcttggacttgagtagtgctttcctcatggga
accaactttcccatcaagatccagaagcatctcttaccagagcacattcagcaccacttt
gctcgtgatggaaggcatttagtcatcgatggtctacatgcggaagcctccgatgacctg
gttcgggaggctgcttataaaattttcctttatcccaatgctgatcagttgaagtgtttg
gaggagttgctaagcagccgagatcttctggcaaacctagtaggctattctaccttttcc
cacagggccctccagggaaccatagcccagactccagagactgtcatgcagttccttgag
aagctatctgaaaagctctgcgaaagaactagaaaagattttgagatgatgcaaggaatg
aaaacaaaactaaatcctcaaaattctgaactaatgccttgggaccctccctactacagt
ggtgtgattcgtgcagagaggtataatattgagcccagtttatattgtccattcttatcc
cttggagcttgcatggaaggcctgaatgtcctatttaacagactgttgggcgtcacctta
tatgcagaacagcccttcaaaggagaggtgtggtgtattgatgtccggaagctggctgtt
gttcatgaatctgaagggttgctgggctacatttactgtgattttttccagcgagcaaac
aagccacagcaggattgccacttcaccatccgagggggcagattaaaggaagatggcagc
tatcagctcccagttgtggttctcatgctgaatctccctcatgcttccagggatttccct
accttattaactcctgggatgatggaaaatctcttccatgaaatggggcatgccatgcac
tcaatgctcggacgaactcggtaccagcatgtcactgggaccaggtgccctactgacttt
gctgaagttccgtctattctgatggagtatttttcaaatgattaccgagtagtcagccag
tttgccaagcattatcagactggtcagccactgccgaaagctatggtgtctcgtctctgt
gaatctaagaaggtctgtgccgccgcagaaatgcagctgcaggtcttttatgccgccctg
gatcaaatctaccatggccagcatcccctgaagaagtcaaccacagacatcctcatggaa
acacaagagcagttttatggcttaccctatgttcctgacactgcctggcagctgaggttc
agccacctggtgggatatggcgccaagtattactcatacctcatgtccagggctgtggca
tccatggtctggaaggagtgcttcctacaggatccctttaacagggccgccggggagcgc
taccgcagagagatgttagcccacggtgggggcaaggaacctatgctcatgattcaaggc
atgctgcagaaatgtccttccatcgatgattttgtggatgcccttgtgtctgacttgaat
ctggactttgaaactttcttcatggattctaaatag

DBGET integrated database retrieval system