KEGG   Rattus norvegicus (rat): 81685
Entry
81685             CDS       T01003                                 

Gene name
Mlh1
Definition
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03430  Mismatch repair
rno03460  Fanconi anemia pathway
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    81685 (Mlh1)
   03460 Fanconi anemia pathway
    81685 (Mlh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81685 (Mlh1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    81685 (Mlh1)
   05226 Gastric cancer
    81685 (Mlh1)
   05213 Endometrial cancer
    81685 (Mlh1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    81685 (Mlh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    81685 (Mlh1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     81685 (Mlh1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 81685
NCBI-ProteinID: NP_112315
RGD: 620937
Ensembl: ENSRNOG00000033809
UniProt: P97679
Position
8
AA seq 758 aa
MAFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVIVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQTFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLQAPPKPCAGNQGTLITVEDLFYNIITRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVSDVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESAALKKAIEAVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEAV
KSTTGIASSSTSGSGDKVHAYQMVRTDSRDQKLDAFMQPVSRRLPSQPQDPVPGNRTEGS
PEKAMQKDQEMSELPAAMEAAADSASLERESVIGASEVAPPAAPPSSPGSSRKRHREDSD
EEMMENDSRKEMTAACYPRRRIINLTSVLSLQEEINDRGHETLREMLRNHTFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSVEIDEEGNLIGLPLLIDSYVPPLEGLPIFIL
RLATEVNWDEEKECFESLSKECAVFYSIRKQYILEESALSGQQSDMPGSPSKPWKWTVEH
IIYKAFRSHLLPPKHFTEDGNVLQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcgtttgtagcaggagttattcggcgcctggacgagacggtagtgaatcgcatagcg
gcgggagaagttatccagcggccggccaatgctatcaaagagatgattgaaaactgttta
gatgcaaaatctacaaatattcaagtgattgttaaagaaggaggcctgaagctaattcag
atccaagacaatggcactggaatcaggaaggaagatttggatattgtgtgtgagaggttc
actacaagtaaactgcagacctttgaggatttagctagtatttccacctatggctttcgt
ggtgaggctttggcaagcataagccatgtggcccatgtcactattacaaccaaaacagct
gatgggaaatgtgcatacagagcaagttactcagatggaaagctacaagcccctcctaaa
ccatgtgcaggcaaccagggtaccctgatcacggtggaagaccttttttacaacataatc
acaaggaggaaagctttaaaaaatcccagtgaagagtacgggaagattttggaagttgtt
ggcaggtactcaatacacaattcaggaattagtttctcagttaaaaaacaaggcgagaca
gtctctgatgtcagaacactacccaatgccacgaccgtagacaacattcgctccatcttt
ggaaatgctgttagtcgagaactgatcgaagttgggtgtgaggataaaaccctagctttc
aaaatgaatggctatatctcgaatgcaaactactcagtgaagaagtgcattttcctactc
ttcatcaaccaccggctggtggaatcggctgccctgaagaaagccatagaagctgtatat
gcagcatatttacccaaaaacacgcacccattcctgtacctcagtttggaaatcagtcct
cagaacgtggatgtcaatgtgcaccccaccaagcatgaagttcactttctccatgaggag
agtattctggagcgtgtgcagcagcacatcgagagcaagctattgggctccaattcatcc
aggatgtattttacccagaccttgcttccaggacttgctgggccctctggggaagccgtt
aaatccacgacaggcatagcttcctcatctactagtggaagtggcgacaaggttcacgct
taccagatggtccgtacagactctcgggaccagaagctcgatgcctttatgcagcctgta
agcaggcgtctgcccagccagccccaggaccctgtccctgggaacaggacagagggctct
cctgaaaaagccatgcagaaggatcaggagatgtctgagctcccggccgccatggaagca
gctgctgacagtgcgagtttggagagagaatcagtgattggggcttcggaagtggcaccc
ccagcggcacccccttccagtccaggcagctccagaaagagacatcgggaggactccgat
gaggaaatgatggaaaatgattcccggaaggaaatgacagctgcttgctacccccggagg
aggatcattaacctcaccagtgttttgagtctccaggaagaaattaacgaccggggtcat
gagactctccgggagatgctccgtaaccatacctttgtgggctgtgtgaatcctcagtgg
gccttggcacagcaccagaccaagctctacctcctcaacactaccaagctcagtgaagaa
ctcttctaccagatactcatttacgattttgccaacttcggtgttctcaggttatcggaa
ccagcaccactctttgacctcgccatgctggccttagacagtcctgaaagtggctggaca
gaggaagatggcccaaaggaaggacttgcagaatacattgttgagtttttgaagaagaaa
gccgagatgcttgcagactatttctctgtggaaattgatgaggaagggaacctgattgga
ttacctctcctgattgatagctatgtgccgcctttggagggactgcctatcttcattctt
cgactggccactgaggtgaactgggatgaagaaaaggagtgtttcgaaagtctcagtaaa
gaatgtgctgtgttttactccattcggaagcaatacatactggaggagtcagccctctca
ggccagcagagtgacatgcctggctccccttcaaagccctggaagtggactgtggaacac
attatctataaagccttccgctcacaccttctgcctccgaagcatttcacagaagatggc
aatgtcctgcagctcgccaacctgccagatctgtacaaagtctttgagcggtgctaa

DBGET integrated database retrieval system