KEGG   Rattus norvegicus (rat): 81686
Entry
81686             CDS       T01003                                 

Gene name
Mmp2
Definition
(RefSeq) 72 kDa type IV collagenase precursor
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04670  Leukocyte transendothelial migration
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05219  Bladder cancer
rno05415  Diabetic cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    81686 (Mmp2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    81686 (Mmp2)
   04915 Estrogen signaling pathway
    81686 (Mmp2)
   04926 Relaxin signaling pathway
    81686 (Mmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81686 (Mmp2)
   05205 Proteoglycans in cancer
    81686 (Mmp2)
  09162 Cancer: specific types
   05219 Bladder cancer
    81686 (Mmp2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    81686 (Mmp2)
   05415 Diabetic cardiomyopathy
    81686 (Mmp2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    81686 (Mmp2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    81686 (Mmp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81686 (Mmp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     81686 (Mmp2)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M10
   81686 (Mmp2)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Other DBs
NCBI-GeneID: 81686
NCBI-ProteinID: NP_112316
RGD: 621316
Ensembl: ENSRNOG00000016695
UniProt: P33436
Position
19
AA seq 662 aa
MEARLVWGVLVGPLRVLCVLCCLLGHAIAAPSPIIKFPGDVSPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKM
DPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggaggcacgattggtctggggagtgctcgtcggccctctgcgggttctctgcgtcctg
tgctgcctgctgggccacgccatcgctgcaccgtcgcccatcatcaagttccccggcgat
gtctcccccaaaacagacaaagagttggcagtgcaatacctgaacactttctatggctgc
cccaaggagagttgcaacctctttgtgctgaaggacaccctcaagaagatgcagaagttc
tttgggctgccccagacaggtgaccttgaccagaacaccatcgagaccatgcggaaacca
agatgtggcaacccagatgtggccaactacaacttctttccccgcaagcccaagtgggac
aagaatcagatcacatacaggatcattggttacacacctgacctggaccctgagacagtg
gatgatgcctttgctcgggccttaaaagtatggagcgacgtaactccactacgcttttct
cgaatccatgatggggaagctgacatcatgatcaactttggtcgatgggagcatggagat
ggatacccatttgacggcaaggacggactcctggcacatgcctttgccccgggcactggt
gttgggggagattctcactttgatgacgatgagctgtggactctaggagaaggacaagtg
gtccgagtaaagtatgggaacgctgatggcgagtactgcaagttccccttcttgtttaat
ggtcgggaatacagcagctgcacagacactggccggagtgacggcttcctctggtgttcc
accacgtacaactttgagaaggacggcaaatatggcttctgtccccacgaagccttgttt
accatgggtggcaatggagatggacagccctgcaagttcccgttccgcttccagggcacc
tcttacaacagctgtaccaccgagggccgtacagacggctaccgctggtgtggcaccacc
gaggattatgaccgggataagaagtatggattctgcccagagactgctatgtccactgtg
ggtggaaattcagaaggtgccccatgtgtcttccccttcacttttctgggcaacaagtat
gagagctgcaccagcgctggccgaagcgatggcaaggtgtggtgtgcaaccacaaccaac
tacgatgatgaccggaagtggggcttctgtcccgaccaaggatatagcctattccttgtg
gcagcccatgagttcggccatgccatggggctggaacactcacaggaccctggagctttg
atggcccctatctacacctacaccaagaacttccgactatccaatgatgacatcaagggg
atccaggagctctatgggccctcccctgatgctgatactgacactggtactggacccacg
cctacactgggacctgtcactcccgagatctgcaagcaagacattgtctttgatggcatt
gctcagatccgtggtgagatcttcttcttcaaggatcggtttatttggcggacagtgaca
ccacgtgacaagcccacaggtcccttgctggtggccacattctggcctgagctcccggaa
aagattgatgccgtgtacgaggccccacaggaagagaaggctgtgttcttcgcagggaat
gagtactgggtctattctgccagcactttggaaagaggataccccaagccactgaccagc
ctgggtttaccccctgatgtccagcaagtagacgctgcctttaactggagtaagaacaag
aagacatacatcttttctggggacaagttctggagatacaatgaagtaaagaagaaaatg
gaccccggtttcccgaagctcatcgcagactcctggaatgccatccctgataacctggat
gcagtcgtggacctgcagggtggtggtcacagctatttcttcaagggtgcttattacctg
aagttggagaaccaaagtctgaagagtgtgaagtttggaagcatcaaatcggactggctg
ggctgctga

KEGG   Rattus norvegicus (rat): 81687
Entry
81687             CDS       T01003                                 

Gene name
Mmp9
Definition
(RefSeq) matrix metalloproteinase-9 precursor
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04915  Estrogen signaling pathway
rno04926  Relaxin signaling pathway
rno05161  Hepatitis B
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05215  Prostate cancer
rno05219  Bladder cancer
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    81687 (Mmp9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    81687 (Mmp9)
   04670 Leukocyte transendothelial migration
    81687 (Mmp9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    81687 (Mmp9)
   04926 Relaxin signaling pathway
    81687 (Mmp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81687 (Mmp9)
   05202 Transcriptional misregulation in cancer
    81687 (Mmp9)
   05206 MicroRNAs in cancer
    81687 (Mmp9)
   05205 Proteoglycans in cancer
    81687 (Mmp9)
  09162 Cancer: specific types
   05219 Bladder cancer
    81687 (Mmp9)
   05215 Prostate cancer
    81687 (Mmp9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    81687 (Mmp9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81687 (Mmp9)
   05418 Fluid shear stress and atherosclerosis
    81687 (Mmp9)
   05415 Diabetic cardiomyopathy
    81687 (Mmp9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    81687 (Mmp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    81687 (Mmp9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     81687 (Mmp9)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M10
   81687 (Mmp9)
SSDB
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PT PG_binding_1 Reprolysin_4 Reprolysin_3 DUF4953 Peptidase_M66
Other DBs
NCBI-GeneID: 81687
NCBI-ProteinID: NP_112317
RGD: 621320
Ensembl: ENSRNOG00000017539
UniProt: P50282
Position
3
AA seq 708 aa
MNPWQPLLLVLLALGYSFAAPHQRQPTYVVFPRDLKTSNLTDTQLAEDYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSETLKAIRSPRCGVPDVGKFQTFEGDLKWHHH
NITYWIQSYTEDLPRDVIDDSFARAFAVWSAVTPLTFTRVYGLEADIVIQFGVAEHGDGY
PFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGAVVPTYFGNANGAPCHFPFTFEGR
SYLSCTTDGRNDGKPWCGTTADYDTDRKYGFCPSENLYTEHGNGDGKPCVFPFIFEGHSY
SACTTKGRSDGYRWCATTANYDQDKLYGFCPTRADVTVTGGNSAGEMCVFPFVFLGKQYS
TCTGEGRSDGRLWCATTSNFDADKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALM
YPMYHYHEDSPLHEDDIKGIQHLYGRGSKPDPRPPATTAAEPQPTAPPTMCPTAPPMAYP
TGGPTVAPTGAPSPGPTGPPTAGPSEAPTESSTPVDNPCNVDVFDAIADIQGALHFFKDG
RYWKFSNHGGSQLQGPFLIARTWPALPAKLNSAFEDPQSKKIFFFSGRKMWVYTGQSVLG
PRSLDKLGLGSEVTLVTGLLPRRGGKALLISRERIWKFDLKSQKVDPQSVTRLDNEFSGV
PWNSHNVFHYQDKAYFCHDKYFWRVSFHNRVNQVDHVAYVTYDLLQCP
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgaacccctggcagcccctgctcctggtgctcctggctctaggctacagctttgctgcc
cctcaccagcgccagccgacttatgtggtcttcccccgagacctgaaaacctccaacctc
acggacacacagctggcagaggattacctgtaccgctatggttacactcgggcagcccag
atgatgggagagaagcagtccctgcggcccgctttgctgatgcttcagaagcagctgtcc
ctgccccagactggtgagctggacagcgagacactaaaggccattcgttcaccgcgctgt
ggtgtcccagacgtgggcaaattccaaaccttcgaaggcgacctcaagtggcaccatcat
aacatcacctattggatccaaagctacaccgaagacttgccgcgagacgtgatcgatgac
tccttcgcgcgcgccttcgcggtgtggagcgcggtgacaccgctcaccttcacccgcgtg
tacgggctcgaagcagacattgtcatccagtttggtgtcgcggagcacggggacgggtat
cccttcgacggcaaggatggtctactggcacacgcctttccccctggccccggcattcag
ggagatgcccacttcgacgacgacgagttgtggtcgctgggcaaaggcgccgtggtcccc
acttactttggaaacgcaaatggtgccccatgtcactttcccttcaccttcgagggacgc
tcctatttgtcctgcaccacggatggccgcaacgacggcaagccttggtgtggcacgaca
gctgactacgacacagacagaaaatatggtttctgccccagtgagaatctctacacggag
catggcaacggagacggcaaaccctgcgtatttccattcatcttcgagggccactcctac
tctgcctgcaccactaaaggtcgctcggatggttatcgctggtgcgccaccaccgccaac
tatgaccaggataagctgtatggcttctgtcctactcgagccgacgtcactgtaactggg
ggcaactcggcaggagagatgtgcgtcttccccttcgtcttcctgggcaagcagtactct
acctgtaccggcgagggccgcagtgatgggcgcctctggtgcgcgacgacgtcgaacttc
gacgctgacaagaagtggggtttctgtccagaccaagggtacagcctgtttctggtggca
gcgcacgagttcggccatgcgctgggcttagatcattcttcagtgccggaagcgctcatg
taccccatgtatcactaccacgaggactcccctctgcatgaagacgacataaaaggcatc
cagcatctgtatggtcgtggctctaaacctgacccaaggcctccagccaccaccgcagct
gaaccacagccgacagctcctcccactatgtgtcccactgcacctcccatggcctatccc
acagggggccccacagtcgcccctacaggcgccccctcacctggccccacaggtccccct
actgctggtccttctgaggcccctacagagtcttcgactccagtagacaatccttgcaat
gtggatgtttttgatgccattgctgatatccagggcgctctgcatttcttcaaggacggt
cggtattggaagttctcgaatcacggaggaagccaattgcagggcccctttcttattgcc
cgcacgtggccagctttgcctgcaaagttgaactcagcctttgaggatccgcagtccaag
aagattttcttcttctctgggcgcaaaatgtgggtgtacacaggccagtcggtgctgggc
cccaggagtctggataagttgggtctaggctcagaggtaaccctggtcaccggacttctc
ccgcgtcgtggagggaaggctctgctgatcagccgggaacgtatctggaaattcgacttg
aagtctcagaaggtggatccccagagcgttactcgcttggataacgagttctctggcgtg
ccctggaactcacacaacgtctttcactaccaagacaaggcctatttctgccatgacaaa
tacttctggcgtgtgagtttccacaaccgggtgaaccaggtggaccacgtggcctacgtg
acctatgacctcctgcagtgcccttga

DBGET integrated database retrieval system