KEGG   Rattus norvegicus (rat): 81716
Entry
81716             CDS       T01003                                 

Gene name
Ggcx
Definition
(RefSeq) gamma-glutamyl carboxylase
  KO
K10106  vitamin K-dependent gamma-carboxylase [EC:4.1.1.90]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00130  Ubiquinone and other terpenoid-quinone biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    81716 (Ggcx)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.90  peptidyl-glutamate 4-carboxylase
     81716 (Ggcx)
SSDB
Motif
Pfam: VKG_Carbox Cupin_2 DoxX
Other DBs
NCBI-GeneID: 81716
NCBI-ProteinID: NP_113944
RGD: 68383
Ensembl: ENSRNOG00000012975
UniProt: O88496
Position
4q31
AA seq 758 aa
MAVHRGSARAAPASDKVQKNKPAQTSGLEQGSRMARIFGFEWADLSSWQSVVTLLNRPTD
PANLAVFRFLFAFLMLLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYT
IMFLGALGMMLGLWYRLSCMLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYW
SVDGLLSAQKKNAHVPLWNYTVLRGQIFIVYFIAGVKKLDADWVEGYSMEHLSRHWLFSP
FKLVLSEELTSLLVVHWCGLLLDLSAGFLLFFDASRPIGLVFVSYFHCMNSQLFSIGMFP
YVMLASSPLFCSAEWPRKLVARCPKRLQELLPAKAAPRPSASCVYKRARAKAGQKPGLRH
HLGTVFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGLT
GELGYLNPGVFTQSRRWKDHADMLKQYATCLSLLLPKYNVTEPQIYFDIWVSINDRFQQR
LFDPRVDIVQAVWSPFRRTPWVQPLLMDLSPWRTKLQDIKSSLDNHTEVVFIADFPGLHL
ENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTLREGEKMQLPAGEYHKVYTVSSSPSCYM
YIYVNTTEVALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFL
RRQRKLQEIERRRNSPLHERFLRFVLRKLYVFRRSFLMTRISLRNLLFGRPSLEQLAQEV
TYANLRPFEPVDESSASNTDSSDPHPSEPDSEHVHSEL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggctgtccaccgtggctctgcacgagctgctcccgcctcagataaagtacagaaaaac
aagcctgcacagacatcggggctggaacagggcagccgaatggcgagaatttttgggttt
gaatgggcagatttatccagctggcagagtgtcgtgaccctacttaaccgaccaacggac
cctgcaaacctggctgtcttccgttttctctttgcattcttgatgctgctggacatcccc
caggaacggggccttagctccctggaccgaaaatacttggatgggctggatgtgtgccgc
ttccccttgctggatgccttgcgcccactgccacttgactggatgtatctcgtctacacc
atcatgtttctgggggcactgggcatgatgctgggcctgtggtaccggctaagctgtatg
ttattcctgctaccatactggtacgtgtttctcctggacaagacatcgtggaacaatcac
tcctatctgtatggtttgttggcctttcagttgacattcatggatgcaaaccactactgg
tctgtggatggcctgctgagtgcccaaaagaagaatgctcacgtgcccctttggaactac
acagtcctgcgtggccagatcttcattgtgtatttcattgcgggtgtgaaaaagctggat
gctgactgggttgagggctactccatggagcatttgtcccggcactggctttttagtccc
ttcaagctagtgttgtcggaggagctgacaagcctgctggtggtacactggtgtgggctt
ctccttgacctctcggctggcttcctgctcttcttcgatgcctccagacccattggcctc
gtcttcgtgtcctactttcactgcatgaactcgcagctcttcagtataggtatgttcccc
tatgtcatgctggccagcagccctctcttctgctcagctgaatggcctcggaagctggta
gcccgatgcccgaaaaggctgcaagagctgctgcctgccaaagctgctcctcggcctagt
gcttcctgtgtgtataagagggcccgggcgaaagctggtcaaaagccaggcctacgccac
catctgggaactgtcttcaccctgctctaccttctggagcagctcttcctgccctattcc
catttcctcacgcagggttacaacaactggacgaatgggctgtatggctattcctgggac
atgatggtgcactcccgctcccaccagcatgtaaagatcacctaccgtgatggcctcact
ggagagctgggctaccttaaccctggggtattcacacagagccggcgctggaaggaccat
gcagacatgctgaagcaatatgccacttgcctgagcctcctgcttcccaagtacaatgtc
actgagccccagatctactttgatatctgggtctccatcaatgaccgcttccagcagagg
ctttttgaccctcgcgtggacatcgtgcaggccgtgtggtcccccttccggcgcacgcct
tgggtgcagccactcttgatggacttatctccctggaggaccaagttacaagacattaag
agcagtctggacaaccacactgaggtggtcttcattgcagatttccctgggcttcacttg
gagaattttgtgagtgaagacctgggcaacaccagcatccagctgctgcagggagaagtc
actgtggaattggtggcagaacagaaaaaccagactcttcgagaaggagagaaaatgcag
ttgcctgctggagagtaccataaagtctatactgtatcatctagtccttcctgctacatg
tacatctatgtcaacactacagaggtcgcactggagcaagacctagcatatctgcaagaa
ttaaaggagaaggtggagaacggaagtgaaacagggcccctgcctccagaacttcagcct
cttttggaaggggaagtaaaagggggccctgagccaacacctctggtccaaacctttctg
agacggcagaggaagctccaagaaattgaacgaaggcgaaatagccctttgcatgagcgc
ttcctccgctttgtgctgcggaagctgtatgtctttcgacgcagcttcctgatgactcga
atttcacttcgaaacctgctatttggccgcccttccctagagcaattagcccaagaggtg
acatatgcaaacttgcgaccatttgaaccagttgatgagtcaagtgcttcaaacacagat
tcttccgatcctcatccttcagagccagattctgagcatgttcactctgagctctga

DBGET integrated database retrieval system