KEGG   Rattus norvegicus (rat): 81727Help
Entry
81727             CDS       T01003                                 

Gene name
Mvk, Lrbp
Definition
(RefSeq) mevalonate kinase
  KO
K00869  mevalonate kinase [EC:2.7.1.36]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00900  Terpenoid backbone biosynthesis
rno01100  Metabolic pathways
rno04146  Peroxisome
Module
rno_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    81727 (Mvk)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    81727 (Mvk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     81727 (Mvk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C GalKase_gal_bdg
Motif
Other DBs
NCBI-GeneID: 81727
NCBI-ProteinID: NP_112325
RGD: 621295
Ensembl: ENSRNOG00000049604
UniProt: P17256
Structure
PDB: 

Position
12q16
AA seq 395 aa AA seqDB search
MLSEVLLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQ
VWDVATLQLLDTGFLEQGDVPAPTLEQLEKLKKVAGLPRDCVGNEGLSLLAFLYLYLAIC
RKQRTLPSLDIMVWSELPPGAGLGSSAAYSVCVAAALLTACEEVTNPLKDRGSIGSWPEE
DLKSINKWAYEGERVIHGNPSGVDNSVSTWGGALRYQQGKMSSLKRLPALQILLTNTKVP
RSTKALVAGVRSRLIKFPEIMAPLLTSIDAISLECERVLGEMAAAPVPEQYLVLEELMDM
NQHHLNALGVGHASLDQLCQVTAAHGLHSKLTGAGGGGCGITLLKPGLERAKVEAAKQAL
TGCGFDCWETSIGAPGVSMHSATSIEDPVRQALGL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcagaagtcctgctggtgtctgctccagggaaagtcattctccatggagaacat
gctgtggtccatggcaaggtagctctggcggtggccttgaacttgagaacatttctcgtg
ctgcgaccgcagagcaatgggaaagtgagcctcaatttaccaaacgtcggtattaagcag
gtctgggatgtggccacacttcagctgctggacacaggctttcttgagcaaggcgatgtc
ccggcacccaccttggagcaactggagaagctgaagaaggtggcgggcctcccccgagac
tgtgtaggcaacgaaggcctgtctctgcttgcctttctgtacctgtacctggctatctgc
cggaaacagaggacactcccaagcctggacatcatggtgtggtcggaactgccccctggg
gcgggcttgggctccagtgcagcctactcggtgtgtgtggcagccgccctcctgactgcc
tgtgaggaggtcaccaacccgctcaaggacaggggctccattggcagttggcccgaggag
gacctgaagtcaattaacaagtgggcctacgagggggagagagtgatccatgggaacccc
tctggcgtggacaattccgtcagcacctggggaggagccctgcgctaccagcaagggaag
atgtcatccttgaagaggctcccagctctgcagatcctgctcaccaacaccaaggtccca
cgaagcaccaaggccctcgtggctggcgtcagaagcaggctaatcaagttccctgagatc
atggccccgctcctgacatcaattgacgcaatctccctggagtgtgagcgcgtgctggga
gagatggcggccgcaccagtcccagaacagtaccttgtcctagaagagctaatggacatg
aaccagcaccatctgaatgcccttggtgtgggccacgcctccctggaccagctctgtcag
gtaacagcagcacatggactgcacagcaagctgactggcgcaggcggcggcggctgtggc
atcaccctcctgaagccaggtctagagcgagcaaaagtggaggccgccaagcaggccctg
accggctgcgggtttgactgctgggagaccagcattggagcgcctggggtctccatgcac
tcagccacctccatagaggaccctgtccgacaagccctgggcctctga

DBGET integrated database retrieval system