KEGG   Rattus norvegicus (rat): 81732Help
Entry
81732             CDS       T01003                                 

Gene name
Actr3, Arp3
Definition
(RefSeq) ARP3 actin related protein 3 homolog
  KO
K18584  actin-related protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    81732 (Actr3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    81732 (Actr3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81732 (Actr3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81732 (Actr3)
   04147 Exosome [BR:rno04147]
    81732 (Actr3)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    81732 (Actr3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     81732 (Actr3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   81732 (Actr3)
  Exosomal proteins of other body fluids (saliva and urine)
   81732 (Actr3)
  Exosomal proteins of bladder cancer cells
   81732 (Actr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin MreB_Mbl FtsA ALP_N Robl_LC7
Motif
Other DBs
NCBI-GeneID: 81732
NCBI-ProteinID: NP_112330
RGD: 71024
Ensembl: ENSRNOG00000003206
UniProt: Q4V7C7
Position
13q12
AA seq 418 aa AA seqDB search
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacggctgccggcctgtgtggtggactgtggcacgggatatacaaaactagga
tatgctggaaatacagaaccacagtttatcatcccatcatgtattgccattaaagagtct
gcaaaagtgggtgatcaagcccagaggagggtgatgaaaggcgtggatgacctagacttc
ttcattggtgatgaagcaatagaaaagcccacatatgcaacaaagtggccaatccgccat
ggtatagttgaagactgggacttaatggaaaggtttatggagcaagtgatttttaaatat
ttaagggcagaacctgaagatcattactttcttttgactgaacctccactgaatactcca
gaaaacagggaatatactgctgagataatgtttgagtccttcaatgttccaggcctgtac
attgctgtgcaggctgttcttgccttagctgcatcctggacctcaagacaagtaggagag
cggacactgacgggtacagtaatagacagtggagacggagtcactcatgtcattcctgtg
gctgaaggatatgttatcggcagctgtattaaacacattccaatcgctggaagagatata
acatattttattcagcaactgctgagagaccgagaagtaggaatccctcctgaacagtcc
ttggaaactgcaaaagcagtgaaggagcgctacagttatgtctgcccagatttagtaaaa
gaatttaacaagtatgacactgatgggtcaaagtggatcaaacagtacaccggagtcaac
gccatctcaaagaaggaattctccattgatgttggctacgagcgatttctgggaccggag
atctttttccatccagagtttgctaatccagattttacacaacctatctcagaagttgta
gatgaagtcattcagaattgccccattgatgtccggcgtcctctctacaagaacattgtc
ctctctggtggttcaaccatgttcagggactttggacgtcgtttgcaaagagatctgaag
agaactgtagatgccaggctgaagttgagtgaggagctgagcggtggcagattgaagccc
aagcctattgatgtacaagttattacacaccacatgcagcggtatgcagtctggtttgga
ggatcaatgctggcttccacgcctgagttctaccaagtatgccacaccaaaaaggattat
gaagaaatcggacctagcatttgtcgtcacaatccagtgtttggagtcatgtcctaa

DBGET integrated database retrieval system