KEGG   Rattus norvegicus (rat): 81735
Entry
81735             CDS       T01003                                 

Gene name
Neo1
Definition
(RefSeq) neogenin isoform X1
  KO
K06766  neogenin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
rno04360  Axon guidance
rno04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    81735 (Neo1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    81735 (Neo1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    81735 (Neo1)
SSDB
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind C2-set_2 Ig_5 fn3_2 Tissue_fac SusE Izumo-Ig TMEM154 EphA2_TM Herpes_UL74
Other DBs
NCBI-GeneID: 81735
NCBI-ProteinID: XP_038938340
RGD: 619837
Ensembl: ENSRNOG00000006490
Position
8
AA seq 1492 aa
MAAEREAGRLLSTSSSRRCCPPRPLLLLLPLLLLLGRPASGAAAAKNGSPPQSAGASVRT
FTPLYFLVEPVDTLSVRGSSVILNCSAYSEPSPNIEWKKDGTFLNLVSDDRRQLLPDGSL
FISNVVHSKHNKPDEGFYQCVATVDNLGTIVSRTAKLAVAGLPRFTSQPEPSSIYVGNSG
ILNCEVNADLVPFVRWEQNRQPLLLDDRIVKLPSGTLVISNATEGDEGLYRCIVESGGPP
KFSDEAELKVLQESEEMLDLVFLMRPSSMIKVIGQSAVLPCVASGLPAPVIRWMKNEDVL
DTESSGRLALLAGGSLEISDVTEDDAGTYFCVADNGNKTIEAQAELTVQVPPEFLKQPAN
IYARESMDIVFECEVTGKPAPTVKWVKNGDVVIPSDYFKIVKEHNLQVLGLVKSDEGFYQ
CIAENDVGNAQAGAQLIILEHDVAIPTLPPTSLTSATTDHLAPATTGPLPSAPRDVVASL
VSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGVARERVENTSQPGEMQVTIQNLMPATVY
IFKVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNIRAYATSPTSITVTWETPLSGNGEI
QNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVRTL
SDVPSAAPQNLSLEVRNSKSIVIHWQPPSSATQNGQITGYKIRYRKASRKSDVTETVVTG
TQLSQLIEGLDRGTEYNFRVAALTVNGTGPATDWLSAETFESDLDESRVPEVPSSLHVRP
LVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITL
KAFNNVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDT
IRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFS
VMVTKGRRSSTWSMTAHGATFELVPTSPPKDVTVVSKEGKPRTIIVNWQPPSEANGKITG
YIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQF
RTPKADSSDKMPNDQALGSAGKGGRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVII
VSIGVITIVVVVIIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNCKDVKPPDLWIHHER
LELKPIDKSPDPNPVMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAG
RRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPSSPWPIGT
SMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLP
TAHVRPSHPLKSFAVPAIPPPGPPIYDPALPSTPLLSQQALNHHLHSVKTASIGTLGRSR
PPMPVVVPSAPEVQEATRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA
NT seq 4479 nt   +upstreamnt  +downstreamnt
atggcggcggagcgtgaagccgggcgactcctcagcacctcctcctcccggcgctgctgc
ccgccacggccgctgctgctgttgctgccgctgctgctgctgctcgggcgcccggcgtcc
ggcgccgcggccgcgaagaacggctccccgccgcagtccgcaggagccagtgttcgaaca
ttcactccgctttattttctggtggagccagtagacacactgtcagttagaggctcttct
gttatattgaattgctccgcatattctgagccttctccaaatattgaatggaagaaagat
gggacttttttaaacttagtgtcagatgatcgccgccagcttctcccagatggatctcta
ttcatcagcaatgtggtgcattccaaacacaataagcctgatgaaggtttctatcagtgt
gtagccacggttgataatcttggaactatcgtcagcagaacagccaagctcgcagtagca
ggtcttccaagatttaccagccaaccagaaccttcctcaatctatgttggaaacagtgga
attctgaattgtgaagttaatgcagatttggtcccatttgttagatgggaacagaacaga
cagccccttcttttggatgacaggattgtcaaacttccaagtggaacactggttatcagc
aatgcgactgaaggagacgagggactctaccgctgcattgttgaaagtggtgggccacca
aagtttagtgatgaagctgaattgaaagttcttcaagaatctgaggaaatgctagacttg
gtatttttgatgcgaccgtcttctatgatcaaagtcattggtcagagtgcagtgttgcca
tgtgttgcctcaggacttcctgctccagtcattaggtggatgaagaatgaagacgtgctt
gacacagaaagctctggaaggttggccttgctagcaggaggcagtttggagatcagtgat
gtcactgaggatgatgctgggacttatttctgtgtagctgataatggaaataagacaatt
gaagctcaggcagagcttaccgtgcaagtgcctcctgagttcttgaaacaacctgctaac
atatacgctcgtgaatccatggatattgtattcgaatgtgaagtcactgggaagccagct
ccaactgtgaagtgggtcaagaatggggatgtagttatcccaagtgattactttaaaatt
gtaaaggaacataatcttcaagttttgggtctggtgaaatcagatgaagggttctatcaa
tgcattgctgagaatgatgttggaaatgcacaagctggagctcagctgataatccttgag
catgatgttgccatcccaacattacctcccacttcactgaccagtgccactactgaccat
ctagcaccagccacaacgggaccactaccttcagctcctcgagatgtcgtggcctccctg
gtctctactcgcttcattaaattgacatggcgtacacctgcatcagatcctcatggagac
aatctcacctattctgtgttctacaccaaggaaggggttgctagggagcgtgttgagaat
accagtcagccaggagagatgcaggtgactattcaaaacttaatgccagcaactgtttac
atcttcaaagttatggctcaaaacaagcatggttctggagagagctcagctcctctacga
gtagaaacacagcctgaggttcagctccctggcccagcacctaatatccgagcttatgca
acatcacctacttctatcactgtcacatgggaaacaccattatctggcaatggggaaatt
caaaattacaaattgtactacatggaaaaaggaacggataaagaacaggatgttgatgtt
tcaagtcactcctatactattaatggactgaagaaatacacggaatatagtttccgagtg
gtggcctacaataaacatggtcctggagtgtctacacaggatgttgctgttcgaacatta
tcagatgtgcccagtgctgctcctcagaatctgtccttagaagtgagaaattcaaagagt
atagtgatccactggcagcccccttcctcagccacacaaaatgggcagattactggctac
aagattcggtatcgaaaggcctcccgaaaaagtgatgtcactgagaccgtggtaactggg
acacagctgtctcagctgattgaaggtcttgatcgggggacagaatataacttccgagta
gctgctctcacagtcaatggtacaggtcccgcaactgattggctgtctgctgagaccttt
gaaagtgacctagatgaatctcgtgttcctgaagtgcctagctctcttcatgtccgtcca
cttgtcactagcattgtagtgagctggactcctccagagaaccagaacattgtggttcga
gggtacgccattggttacggcattggcagccctcatgcccagaccatcaaagtggactac
aaacagcgctattacaccatcgaaaacttggatccaagctctcattacgtgattaccttg
aaagcatttaacaatgttggtgaaggcatccctctttatgagagtgctgtgaccagacct
cacacagacacttctgaagttgatttatttgttattaatgctccatacactccagtgcca
gatcccactcccatgatgccaccagtgggagttcaggcttccattctgagtcacgacacc
ataagaattacctgggcagacaactccctgcccaaacaccagaagattacagactcccgc
tactacacagtccggtggaagaccaacatcccagcaaacaccaagtacaagaatgcaaac
gcaacaacgttaagctatttggttactggtttaaagccaaacacactgtatgagttctct
gtgatggtgaccaaaggcagaaggtcaagcacgtggagtatgacagctcatggtgctacc
tttgaattagttcctacttctccacctaaggatgtgacagttgtgagtaaagaaggaaaa
ccgagaacgataatagtgaactggcagcctccctctgaagctaatggcaagattacaggt
tacatcatctattacagcacagatgtgaatgcagagatccatgactgggtgattgaacct
gttgtgggaaacaggctgactcaccagattcaagagttaacactcgacacaccatactac
ttcaaaatccaggcccggaactcaaagggcatggggcccatgtctgaagctgtgcagttc
agaacacctaaagcggactcctctgataaaatgcctaatgaccaagccttaggatcagca
gggaaaggaggccgactaccagacctaggatccgactacaaacctccaatgagtggcagc
aacagcccccatgggagccccacctctcctctagacagcaatatgctgctggtcatcatt
gtctccatcggcgtcatcaccatcgtagtggttgtgatcattgctgtcttttgtacccgg
cgcaccacctctcaccagaagaagaaacgagctgcgtgcaaatcagtgaacggctcccat
aagtacaagggcaattgcaaagacgtgaagcctccggacctgtggatccatcatgagagg
ctggagttgaagcctattgacaagtctccagatccaaaccctgtcatgactgatactcca
atccctcggaactctcaagatatcacaccagtcgacaattccatggatagcaatatccat
caaaggcggaattcatacagagggcatgagtcagaggacagcatgtctaccctggctgga
aggaggggaatgagaccaaaaatgatgatgccctttgactctcagccacctcagcctgtg
attagtgcccatcccatccattccctcgataaccctcaccatcatttccactccagcagc
ctcgcttctccagcccgcagtcacctctaccacccaagcagcccatggcccattggcaca
tccatgtccctttcagacagggccaattccacagaatctgttcgaaatacccccagcacg
gacaccatgccagcatcctcgtctcaaacatgctgcactgatcatcaggatcctgaaggt
gctactagctcttcttacttggccagctcccaggaggaagactcaggccagagtcttccc
acagctcatgttcgcccttcccacccattgaagagcttcgccgtaccagcaatcccaccc
ccgggacctcctatctatgatcctgcactgccaagcacaccattactgtcccagcaagct
ctcaaccatcaccttcactcagtgaaaacagcctccatcgggactttaggaaggagccgg
cctcctatgccagtggttgtaccgagtgcccctgaggtacaggaggccaccaggatgctg
gaagactccgagagtagctatgaaccagatgagctgaccaaagagatggcccacctggaa
ggactcatgaaggacctaaatgccatcacaacggcttga

DBGET integrated database retrieval system