KEGG   Rattus norvegicus (rat): 81739Help
Entry
81739             CDS       T01003                                 

Gene name
P2rx3
Definition
(RefSeq) purinergic receptor P2X 3
  KO
K05217  P2X purinoceptor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    81739 (P2rx3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81739 (P2rx3)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    81739 (P2rx3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    81739 (P2rx3)
Ion channels [BR:rno04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   81739 (P2rx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P2X_receptor WAP UPF0014
Motif
Other DBs
NCBI-GeneID: 81739
NCBI-ProteinID: NP_112337
RGD: 620253
Ensembl: ENSRNOG00000008552
UniProt: P49654
Position
3q24
AA seq 397 aa AA seqDB search
MNCISDFFTYETTKSVVVKSWTIGIINRAVQLLIISYFVGWVFLHEKAYQVRDTAIESSV
VTKVKGFGRYANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPENEEKYRCVSDS
QCGPERFPGGGILTGRCVNYSSVLRTCEIQGWCPTEVDTVEMPIMMEAENFTIFIKNSIR
FPLFNFEKGNLLPNLTDKDIKRCRFHPEKAPFCPILRVGDVVKFAGQDFAKLARTGGVLG
IKIGWVCDLDKAWDQCIPKYSFTRLDGVSEKSSVSPGYNFRFAKYYKMENGSEYRTLLKA
FGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGADHYKARKFEE
VTETTLKGTASTNPVFASDQATVEKQSTDSGAYSIGH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtatatcagacttcttcacctacgagactaccaagtcggtggttgtgaagagc
tggaccattgggatcatcaaccgagccgtccagctgctgattatctcctactttgtgggg
tgggttttcttgcatgagaaggcctaccaagtgagggacaccgccattgagtcctcagta
gttacaaaggtgaaaggcttcgggcgctatgccaacagagtcatggacgtgtcggattat
gtgaccccaccccagggcacctctgtctttgtcatcatcaccaaaatgatcgttactgaa
aatcaaatgcaaggattctgtccagagaatgaagagaagtaccgctgtgtgtctgacagc
cagtgtgggcctgaacgcttcccaggtggggggatcctcaccggccgctgcgtgaactac
agctctgttctccggacctgtgagatccagggctggtgccccactgaggtggacaccgtg
gagatgcctatcatgatggaggctgagaacttcaccattttcatcaagaacagcatccgt
ttccctctcttcaactttgagaagggaaacctcctgcctaacctcaccgacaaggacata
aagaggtgccgcttccaccctgaaaaggccccattttgccccatcttgagggtaggggat
gtggttaagtttgctggacaggattttgccaagctggcccgcacgggtggcgttctgggt
attaagatcggctgggtgtgcgatctagacaaggcctgggaccagtgcatccctaaatat
tccttcactcggctggatggagtttctgagaaaagcagtgtttcccctggctacaacttc
aggtttgccaaatactataagatggagaacggcagcgagtaccgcacactcctgaaggct
tttggcatccgctttgatgtgctggtatatgggaacgctggcaagttcaacatcatcccc
accattatcagctcggtggcggccttcacttctgtgggagtgggcactgttctctgtgac
atcatcctgctcaatttcctcaaaggggctgatcactacaaagccaggaagtttgaggag
gtgactgagacaacactgaagggtactgcgtcaaccaacccagtgttcgccagtgaccag
gccactgtggagaagcagtctacagactcaggggcctattctattggtcactag

DBGET integrated database retrieval system