KEGG   Rattus norvegicus (rat): 81742Help
Entry
81742             CDS       T01003                                 

Gene name
Pde1c
Definition
(RefSeq) phosphodiesterase 1C
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04020  Calcium signaling pathway
rno04740  Olfactory transduction
rno04742  Taste transduction
rno04924  Renin secretion
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    81742 (Pde1c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    81742 (Pde1c)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    81742 (Pde1c)
  09157 Sensory system
   04740 Olfactory transduction
    81742 (Pde1c)
   04742 Taste transduction
    81742 (Pde1c)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    81742 (Pde1c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     81742 (Pde1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 81742
NCBI-ProteinID: NP_112340
RGD: 68332
Ensembl: ENSRNOG00000012337
UniProt: Q63421
Position
4q24
AA seq 768 aa AA seqDB search
MTDTSHKKEGFKKCRSATFSIDGYSFTIVANEAGDKNARPLARFSRSKSQNCLWNSLIDG
LTGNVKEKPRPTIVQDTRPPEEILADELPQLDSPEALVKTSFRLRSLVKQLERGEASVVD
LKKNLEYAATVLESVYIDETRRLLDTEDELSDIQSDAVPSEVRDWLASTFTRQMGMMLRR
SDEKPRFKSIVHAVQAGIFVERMYRRTSNMVGLSYPPAVIDALKDVDTWSFDVFSLNEAS
GDHALKFIFYELLTRYDLISRFKIPISALVSFVEALEVGYSKHKNPYHNLMHAADVTQTV
HYLLYKTGVANWLTELEIFAIIFSAAIHDYEHTGTTNNFHIQTRSDPAILYNDRSVLENH
HLSAAYRLLQEDEEMNILVNLSKDDWREFRTLVIEMVMATDMSCHFQQIKAMKTALQQPE
AIEKPKALSLMLHTADISHPAKAWDLHHRWTMSLLEEFFRQGDREAELGLPFSPLCDRKS
TMVAQSQVGFIDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSINSSDAKR
SGVKSSGSEGSAPINNSVIPVDYKSFKATWTEVVQINRERWRAKVPKEEKAKKEAEEKAR
LAAEEKQKEMEAKSQAEQGTTSKAEKKTSGETKGQVNGTRTSKGDNPRGKNSKGDKAGEK
QQNGDLKDGKNKADKKDHSNTGNESKKADGTKKRSHGSPAPSTSSTSRLTLPVIKPPLRH
FKRPAYASSSYAPSVPKKTDDHPVRYKMLDQRIKIKKIQNISHHWNKK
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgacggacaccagccacaagaaggagggcttcaagaaatgtaggagcgccactttcagc
atcgacgggtacagcttcaccatcgttgcaaatgaagcaggagataagaatgccagaccc
cttgcacgcttctcccgatctaagtcacagaactgtctgtggaactccctcattgatggc
ctcactgggaatgttaaggagaagccacggccaacaattgtccaggacacccgaccccca
gaagaaattctggcagatgaattgccacaactggatagcccagaagctttggtgaagaca
tccttcaggttacggtctttggtcaagcaattagagcgaggagaggcctctgtggtagat
cttaagaagaatctggaatatgcagccacagtgcttgagtctgtatatattgatgaaaca
aggcgcctgctggatacagaggatgaacttagtgacattcagtcagatgctgtgccttct
gaagttcgggattggctggcctccaccttcactcggcagatggggatgatgcttaggaga
agcgatgagaagcccaggttcaagagcattgtccatgcagtgcaagctgggatatttgtg
gagagaatgtatagacggacatcaaacatggttgggttgagctatccaccggctgtaatc
gatgcactgaaggatgtggacacatggtccttcgatgtcttttccctcaatgaggccagt
ggagatcatgctttgaagttcattttctatgaattactcacacgttatgacttgatcagc
cgttttaagatacccatttctgcacttgtctcatttgtggaggcccttgaagttggttac
agcaagcacaaaaatccttaccataacctgatgcatgccgccgatgtcacacagactgtg
cattacctcctttataagacgggagtagcaaactggctgacggagctggagatctttgca
ataatcttctcggctgccatccatgactatgaacatactggaactaccaacaatttccac
attcagactcggtcggatccagctatcctgtacaatgacagatctgtactggagaaccac
cacttgagtgcagcctaccgtcttctccaggaagatgaagagatgaatattctggtcaac
ctctcaaaggatgactggagggagtttcgaactttggtaatcgagatggtaatggccaca
gatatgtcctgtcatttccaacaaatcaaagccatgaagacagccctgcagcaaccagaa
gcaattgaaaagccgaaagccttatccctcatgctgcacacagcagacatcagtcatcct
gcgaaagcgtgggacttgcaccaccgctggaccatgtctctcctggaggagttctttaga
cagggtgacagagaagctgagctggggctgccattttctcctctgtgtgaccgaaagtca
accatggttgctcagtcacaagtgggttttattgacttcattgtggaacctaccttcact
gtgctcacggatatgactgagaagattgtgagtccattaatcgatgaaacctcccagact
ggcgggacaggccagaggcgatcaagtttgaacagcatcaactcatccgatgcaaagcga
tcaggtgtcaagagttctgggtcagaaggaagtgctcccatcaacaattctgtcatccct
gttgactacaagagttttaaagccacttggaccgaggtggtgcagatcaatcgggagcgg
tggcgagccaaggttcccaaagaagagaaagccaagaaggaagctgaagagaaggctcgc
ctagctgctgaggaaaagcaaaaggaaatggaagccaaaagccaagctgaacaaggcaca
accagcaaagctgaaaaaaagacatcaggagaaacaaaaggtcaagtcaacggaacacgc
acaagcaagggtgacaaccctcgtgggaagaactccaaaggcgacaaggcaggcgaaaag
cagcagaatggtgacttgaaagatggtaaaaataaggcagacaagaaggatcactccaac
accggaaatgagtcaaagaaagcagatggtaccaagaagcgttctcatggctcacctgct
ccaagcactagttccacaagtcgccttaccttgccagtcatcaagcctcctttgcgtcac
tttaagcgtcctgcttatgcatctagttcctacgcaccttccgttccaaagaaaactgat
gatcatcccgtaaggtacaagatgctggatcagcggatcaagataaaaaagatccagaac
atctctcatcactggaacaaaaagtag

DBGET integrated database retrieval system