KEGG   Rattus norvegicus (rat): 81745
Entry
81745             CDS       T01003                                 

Gene name
Pdpk1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno03320  PPAR signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04360  Axon guidance
rno04510  Focal adhesion
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04931  Insulin resistance
rno04960  Aldosterone-regulated sodium reabsorption
rno05145  Toxoplasmosis
rno05205  Proteoglycans in cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05223  Non-small cell lung cancer
rno05231  Choline metabolism in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    81745 (Pdpk1)
   04071 Sphingolipid signaling pathway
    81745 (Pdpk1)
   04151 PI3K-Akt signaling pathway
    81745 (Pdpk1)
   04152 AMPK signaling pathway
    81745 (Pdpk1)
   04150 mTOR signaling pathway
    81745 (Pdpk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    81745 (Pdpk1)
  09143 Cell growth and death
   04210 Apoptosis
    81745 (Pdpk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81745 (Pdpk1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    81745 (Pdpk1)
   04664 Fc epsilon RI signaling pathway
    81745 (Pdpk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    81745 (Pdpk1)
   03320 PPAR signaling pathway
    81745 (Pdpk1)
   04919 Thyroid hormone signaling pathway
    81745 (Pdpk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    81745 (Pdpk1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    81745 (Pdpk1)
  09158 Development and regeneration
   04360 Axon guidance
    81745 (Pdpk1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    81745 (Pdpk1)
   05231 Choline metabolism in cancer
    81745 (Pdpk1)
  09162 Cancer: specific types
   05215 Prostate cancer
    81745 (Pdpk1)
   05213 Endometrial cancer
    81745 (Pdpk1)
   05223 Non-small cell lung cancer
    81745 (Pdpk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    81745 (Pdpk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81745 (Pdpk1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    81745 (Pdpk1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    81745 (Pdpk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    81745 (Pdpk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81745 (Pdpk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     81745 (Pdpk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   81745 (Pdpk1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    81745 (Pdpk1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH ABC1 Haspin_kinase Kdo TCAD9
Other DBs
NCBI-GeneID: 81745
NCBI-ProteinID: NP_112343
RGD: 620307
Ensembl: ENSRNOG00000006136
UniProt: O55173
Position
10
AA seq 559 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPSSSPGIPSGVSRQGSTMDGTTAEAR
PSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPDSKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESITWENLHQQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSAVDASLPQRSGSNIEQYIH
DLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCR
KIQEVWRQQYQSSPDAAVQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgctgtgcccattcagtccagtgtggtgcta
tgttcctgcccatccccatcaatggtgaggtcccagactgagcccagctcgtcccctggc
attcctagtggtgttagcaggcagggatccaccatggacggcaccacagctgaagcccga
ccaagcaccaaccccttgcagcagcaccctgcccagctgccaccacagcctcgcaagaaa
cgccctgaagacttcaagtttgggaaaattcttggcgagggctctttttcgacagttgtt
ctggcccgagaactggccacttccagagaatatgctattaaaattctggagaaacgtcat
ataataaaagaaaacaaagtcccgtatgtaactagagagagagatgtgatgtcacgcctg
gatcaccccttctttgtgaaactttactttacgtttcaggacgacgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctactcaaatacatccgcaaaatcggttcattt
gatgagacctgtacccggttttacacagctgagattgtgtctgctttagagtacttgcat
ggcaagggcatcattcacagagaccttaaaccagaaaacatcttgttaaacgaagacatg
cacatccagatcacagattttggaacagccaaagtattatccccagacagcaaacaagct
agagccaattcatttgtaggaacagcgcagtatgtttctccagagctgctcacagagaag
tcggcgtgtaaaagttcagacctttgggcccttggatgtataatctatcagcttgtggca
ggacttccaccattcagagccggaaatgaatatcttatatttcagaagatcattaagttg
gaatatgatttcccagaaaaattcttccctaaggcaagagatcttgtggaaaaactcttg
gttttagatgccacaaagcgtttaggctgtgaagagatggaagggtacgggcctctcaaa
gctcatccattctttgagtccatcacgtgggagaatctgcaccagcagacgcctccgaag
ctcacagcttacttgccagccatgtcagaagatgatgaagactgctatggcaattacgac
aatctcctgagccagtttggctgcatgcaggtgtcatcctcctcctcttcccactccctg
tctgcggtggatgccagcctgccccagaggtcgggcagcaacatagagcagtacattcat
gatttggacactaactcttttgaactagacttacagttttcagaagatgaaaaaaggttg
ttattggaaaagcaagccggtggaaacccttggcaccagtttgtagaaaataatctaata
ttaaaaatgggcccagtggataagcgaaagggtttatttgcaagacgacggcagttatta
ctcacagaagggccacatttatattatgtcgatcctgtcaacaaggtcttaaaaggtgaa
attccatggtcacaagaactccgaccagaggccaagaattttaaaactttcttcgtccac
acgcctaacaggacgtattacctgatggatccaagcgggaatgctcacaagtggtgcaga
aagatccaggaggtttggaggcaacagtaccagagcagtccagatgctgctgtgcagtga

DBGET integrated database retrieval system