KEGG   Rattus norvegicus (rat): 81747
Entry
81747             CDS       T01003                                 

Gene name
Pi4kb
Definition
(RefSeq) phosphatidylinositol 4-kinase beta
  KO
K19801  phosphatidylinositol 4-kinase B [EC:2.7.1.67]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    81747 (Pi4kb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    81747 (Pi4kb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     81747 (Pi4kb)
SSDB
Motif
Pfam: PI3_PI4_kinase DUF4135 ABC1
Other DBs
NCBI-GeneID: 81747
NCBI-ProteinID: NP_112345
RGD: 621214
Ensembl: ENSRNOG00000021024
UniProt: O08561
Position
2
AA seq 816 aa
MGDMVVEPATLKPTSEPTPSPSGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVK
LLHGGVAISSKGSPLELVNGDGVDNEIRCLDDPPTEIREEEDEMEPGVVSGTAKGTRRRR
QNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLL
NMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLI
LSDELKPAHRKRELPTLSPAPDTGLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVEN
EDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLN
HKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTNVPARIPE
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCD
NISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEK
VRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKI
LVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGY
CLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGG
LNGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSM
TEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgggagacatggtagtggagcctgccaccctgaagccaacttctgagcctactcctagc
ccatcagggaataacgggggctccctactaagcgtcatcacggagggggtcggggaactg
tcagtgattgaccctgaggtggcccagaaggcctgccaggaggtactggagaaagtcaag
cttttgcatggaggtgtagccatctctagcaaaggcagcccactggagttggttaatggg
gatggtgtggacaatgagatccgttgcctagatgatccacctaccgagatcagggaggaa
gaagatgagatggagcctggtgtggtctctggcacagccaaaggaacaagaagaagacga
cagaacaactcagccaaacagtcttggctcctgaggctgtttgaatcaaaactatttgac
atctctatggccatttcatacttgtataactccaaggagccgggagtgcaagcctacatt
ggcaaccggctcttctgctttcgcaatgaggatgtggacttctatttgccccagttgctt
aacatgtatatccatatggatgaggatgtgggtgatgccattaaaccctacatagtccac
cgttgtcgccagagcatcaacttttccctccagtgtgccctgttgcttggggcctactct
tcagacatgcacatttctactcaacgacactcccgagggaccaagttacggaagctaatc
ctctcagatgagctgaagccagctcaccgaaagagggagctgccaactttaagcccagcc
cctgacacaggactgtctccctctaaaaggactcaccagcgctctaagtcagatgccacg
gccagcataagtctcagcagcaacctgaaacgaacagccagcaaccctaaagtggagaat
gaggatgaggagctctcctccagcaccgagagtattgataattcattcagttcccctgtc
cggctggcccctgagcgagaattcatcaagtccttgatggcaatcggcaaacggctggcc
acgctccccactaaagagcaaaaaacacaaaggctgatctcagaactttccctgctcaac
cataagctccctgcccgagtctggctgcccacagctggctttgaccaccacgtggtccgt
gtgccccacacacaagctgttgtcctcaattccaaggataaggctccctacctgatctat
gtggaagttcttgaatgtgaaaacttcgacacaactaatgttcctgcccggattcctgaa
aaccgaattcggagtacgaggtctgtggagaacctgccggaatgtggtatcactcacgag
cagcgggctggcagcttcagcactgtgcccaattatgacaatgacgatgaagcctggtcg
gtggatgacataggcgagctgcaggtggagctcccagaagtgcacaccaacagctgtgac
aacatctctcagttctcggtggacagcatcaccagccaggagagcaaggagcctgtgttc
attgcggcaggggacatcagacggcgcctttcagaacagctggctcacactcccacagcc
ttcaaacgagaccctgaagacccttctgcagtcgccctcaaagagccctggcaggagaaa
gtgcggaggatcagagaaggttccccgtatggccatcttcccaattggcgactcctttca
gtcattgtcaagtgtggagatgaccttcgccaggagctgctggctttccaggtgttgaaa
caactgcagtccatttgggaacaggagcgagtgcctctttggatcaagccatataagatt
cttgtgatttcagctgacagtggcatgattgaaccagtagtcaacgctgtgtccatccac
caggtgaagaaacagtcacagctctccttgctcgattacttcctgcaggagcatggcagt
tacaccactgaggcattcctcagtgcccagcgcaattttgtgcaaagttgtgctggctac
tgcttggtctgctacctattacaagtcaaggacaggcacaatgggaacatccttctggac
gcagaaggtcacatcatccacatcgactttggcttcatcctttccagctcaccccgaaac
ctgggcttcgagacgtcagcctttaagctgaccacagaatttgtggatgtaatgggcggc
ctgaacggtgatatgttcaactactataagatgctcatgctgcaagggctgatcgctgct
cgcaaacacatggacaaggtggtacagattgtggagatcatgcagcaaggttctcagctt
ccttgcttccatggctccagcaccattcgcaacctcaaagagaggttccacatgagcatg
actgaggagcagctgcagctgctggtggagcagatggtggacggcagcatgaggtccatc
accaccaaactctacgatggcttccagtacctcaccaatggcatcatgtga

DBGET integrated database retrieval system